From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan005892000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • Zn-dependent alcohol dehydrogenase
  • strand?: -
  • coordinates?: 5963294..5963692
  • synteny block?: BlockID0046370
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2312
    08BA02176:
    C248_2421
    11819-97:
    MS7_2392
    71193:
    ST398NM01_2428
    ECT-R 2:
    ECTR2_2234
    ED133:
    SAOV_2421c
    ED98:
    SAAV_2439
    HO 5096 0412:
    SAEMRSA15_22740
    JH1:
    SaurJH1_2444
    JH9:
    SaurJH9_2398
    JKD6008:
    SAA6008_02412
    JKD6159:
    SAA6159_02277
    LGA251:
    SARLGA251_21590
    M013:
    M013TW_2335
    MRSA252:
    SAR2462
    MSHR1132:
    SAMSHR1132_22020
    MSSA476:
    SAS2265
    Mu3:
    SAHV_2357
    Mu50:
    SAV2373
    MW2:
    MW2295
    RF122:
    SAB2253c
    ST398:
    SAPIG2428
    T0131:
    SAT0131_02564
    TCH60:
    HMPREF0772_10815
    TW20:
    SATW20_25050
    USA300_TCH1516:
    USA300HOU_2357
    VC40:
    SAVC_10735

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRRLLYSFLFYMIIGLFSGFFYRELTKAYDFTGTTQLSLVHTHTLILGMFMFLILLPLEK
    N315            MRRLLYSFLFYMIIGLFSGFFYRELTKAYDFTGTTQLSLVHTHTLILGMFMFLILLPLEK
    NCTC8325        MRRLLYSFLFYMIIGLFSGFFYRELTKAYDFTGTTQLSLVHTHTLILGMFMFLILLPLEK
    Newman          MRRLLYSFLFYMIIGLFSGFFYRELTKAYDFTGTTQLSLVHTHTLILGMFMFLILLPLEK
    USA300_FPR3757  MRRLLYSFLFYMIIGLFSGFFYRELTKAYDFTGTTQLSLVHTHTLILGMFMFLILLPLEK
                    ************************************************************

    COL             LFKLSSYYLFNWFFYVYNIGVIVTIGMMVTKGFFQVTGKSYSPEAFAGFAGIGHTGMLAG
    N315            LFKLSSYYLFNWFFYVYNIGVIVTIGMMVTKGFFQVTGKSYSPEAFAGFAGIGHTGMLAG
    NCTC8325        LFKLSSYYLFNWFFYVYNIGVIVTIGMMVTKGFFQVTGKSYSPEAFAGFAGIGHTGMLAG
    Newman          LFKLSSYYLFNWFFYVYNIGVIVTIGMMVTKGFFQVTGKSYSPEAFAGFAGIGHTGMLAG
    USA300_FPR3757  LFKLSSYYLFNWFFYVYNIGVIVTIGMMVTKGFFQVTGKSYSPEAFAGFAGIGHTGMLAG
                    ************************************************************

    COL             LLLLFFLLRQAILKEPRDESFKK
    N315            LLLLFFLLRQAILKEPRDESFKK
    NCTC8325        LLLLFFLLRQAILKEPRDESFKK
    Newman          LLLLFFLLRQAILKEPRDESFKK
    USA300_FPR3757  LLLLFFLLRQAILKEPRDESFKK
                    ***********************