From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005895000
  • symbol?:
  • description?: TetR family transcriptional regulator

      descriptions from strain specific annotations:

    • TetR family transcriptional regulator
    • Transcriptional regulator, TetR family
    • regulatory proteins, tetR family protein
    • TetR family regulatory protein
    • transcriptional regulator TetR family protein
    • bacterial regulatory s, tetR family protein
  • strand?: +
  • coordinates?: 5965370..5965993
  • synteny block?: BlockID0046400
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2314
    08BA02176:
    C248_2423
    11819-97:
    MS7_2394
    71193:
    ST398NM01_2430
    ECT-R 2:
    ECTR2_2236
    ED133:
    SAOV_2423
    ED98:
    SAAV_2441
    HO 5096 0412:
    SAEMRSA15_22760
    JH1:
    SaurJH1_2447
    JH9:
    SaurJH9_2401
    JKD6008:
    SAA6008_02414 (tetR)
    JKD6159:
    SAA6159_02279 (tetR)
    LGA251:
    SARLGA251_21610
    M013:
    M013TW_2337
    MRSA252:
    SAR2464
    MSHR1132:
    SAMSHR1132_22040
    MSSA476:
    SAS2267
    Mu3:
    SAHV_2359
    Mu50:
    SAV2375
    MW2:
    MW2297
    RF122:
    SAB2255
    ST398:
    SAPIG2430
    T0131:
    SAT0131_02566
    TCH60:
    HMPREF0772_10813
    TW20:
    SATW20_25070
    USA300_TCH1516:
    USA300HOU_2360
    VC40:
    SAVC_10745

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKEDRRIRKTKSSIKQAFTKLLQEKDLEKITIRDITTRADINRGTFYLHYEDKYMLLADM
    N315            MKEDRRIRKTKSSIKQAFTKLLQEKDLEKITIRDITTRADINRGTFYLHYEDKYMLLADM
    NCTC8325        MKEDRRIRKTKSSIKQAFTKLLQEKDLEKITIRDITTRADINRGTFYLHYEDKYMLLADM
    Newman          MKEDRRIRKTKSSIKQAFTKLLQEKDLEKITIRDITTRADINRGTFYLHYEDKYMLLADM
    USA300_FPR3757  MKEDRRIRKTKSSIKQAFTKLLQEKDLEKITIRDITTRADINRGTFYLHYEDKYMLLADM
                    ************************************************************

    COL             EDEYISELTTYTQFDLLRGSSIEDIANTFVNNILKNIFQHIHDNLEFYHTILQLERTSQL
    N315            EDEYISELTTYTQFDLLRGSSIEDIANTFVNNILKNIFQHIHDNLEFYHTILQLERTSQL
    NCTC8325        EDEYISELTTYTQFDLLRGSSIEDIANTFVNNILKNIFQHIHDNLEFYHTILQLERTSQL
    Newman          EDEYISELTTYTQFDLLRGSSIEDIANTFVNNILKNIFQHIHDNLEFYHTILQLERTSQL
    USA300_FPR3757  EDEYISELTTYTQFDLLRGSSIEDIANTFVNNILKNIFQHIHDNLEFYHTILQLERTSQL
                    ************************************************************

    COL             ELKINEHIKNNMQRYISINHSIGGVPEMYFYSYVSGATISIIKYWVMDKQPISVDELAKH
    N315            ELKINEHIKNNMQRYISINHSIGGVPEMYFYSYVSGATISIIKYWVMDKQPISVDELAKH
    NCTC8325        ELKINEHIKNNMQRYISINHSIGGVPEMYFYSYVSGATISIIKYWVMDKQPISVDELAKH
    Newman          ELKINEHIKNNMQRYISINHSIGGVPEMYFYSYVSGATISIIKYWVMDKQPISVDELAKH
    USA300_FPR3757  ELKINEHIKNNMQRYISINHSIGGVPEMYFYSYVSGATISIIKYWVMDKQPISVDELAKH
                    ************************************************************

    COL             VHNIIFNGPLRIMAENRLHKSNLDSLT
    N315            VHNIIFNGPLRIMAENRLHKSNLDSLT
    NCTC8325        VHNIIFNGPLRIMAENRLHKSNLDSLT
    Newman          VHNIIFNGPLRIMAENRLHKSNLDSLT
    USA300_FPR3757  VHNIIFNGPLRIMAENRLHKSNLDSLT
                    ***************************