From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005914000
  • symbol?:
  • description?: heat shock protein Hsp20

      descriptions from strain specific annotations:

    • heat shock protein Hsp20
    • Molecular chaperone, small heat shock protein
    • hsp20/alpha crystallin family protein
    • HSP20 family protein
    • small heat shock protein Hsp20
    • putative small heat shock protein
    • Small heat shock protein
  • strand?: +
  • coordinates?: 5982460..5982899
  • synteny block?: BlockID0046580
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2324
    08BA02176:
    C248_2434
    11819-97:
    MS7_2404
    71193:
    ST398NM01_2440
    ECT-R 2:
    ECTR2_2246
    ED133:
    SAOV_2433
    ED98:
    SAAV_2452
    HO 5096 0412:
    SAEMRSA15_22860
    JH1:
    SaurJH1_2458
    JH9:
    SaurJH9_2411
    JKD6008:
    SAA6008_02426
    JKD6159:
    SAA6159_02290
    LGA251:
    SARLGA251_21710
    M013:
    M013TW_2347
    MRSA252:
    SAR2475
    MSHR1132:
    SAMSHR1132_22150
    MSSA476:
    SAS2277
    Mu3:
    SAHV_2371
    Mu50:
    SAV2387
    MW2:
    MW2307
    RF122:
    SAB2266
    ST398:
    SAPIG2440
    T0131:
    SAT0131_02577
    TCH60:
    HMPREF0772_10801 (hsp20)
    TW20:
    SATW20_25170
    USA300_TCH1516:
    VC40:
    SAVC_10800

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MILNFNQFENQNFFNGNPSDTFKDLGKQVFNYFSTPSFVTNIYETDELYYLEAELAGVNK
    N315            --MNFNQFENQNFFNGNPSDTFKDLGKQVFNYFSTPSFVTNIYETDELYYLEAELAGVNK
    NCTC8325        MILNFNQFENQNFFNGNPSDTFKDLGKQVFNYFSTPSFVTNIYETDELYYLEAELAGVNK
    Newman          MILNFNQFENQNFFNGNPSDTFKDLGKQVFNYFSTPSFVTNIYETDELYYLEAELAGVNK
    USA300_FPR3757  MILNFNQFENQNFFNANPSDTFKDLGKQVFNYFSTPSFVTNIYETDELYYLEAELAGVNK
                      :************.********************************************

    COL             EDISIDFNNNTLTIQATRSAKYKSEQLILDERNFESLMRQFDFEAVDKQHITASFENGLL
    N315            EDISIDFNNNTLTIQATRSAKYKSEQLILDERNFESLMRQFDFEAVDKQHITASFENGLL
    NCTC8325        EDISIDFNNNTLTIQATRSAKYKSEQLILDERNFESLMRQFDFEAVDKQHITASFENGLL
    Newman          EDISIDFNNNTLTIQATRSAKYKSEQLILDERNFESLMRQFDFEAVDKQHITASFENGLL
    USA300_FPR3757  EDISIDFNNNTLTIQATRSAKYKSEQLILDERNFESLMRQFDFEAVDKQHITASFENGLL
                    ************************************************************

    COL             TITLPKIKPSNETTSSTSIPIS
    N315            TITLPKIKPSNETTSSTSIPIS
    NCTC8325        TITLPKIKPSNETTSSTSIPIS
    Newman          TITLPKIKPSNETTSSTSIPIS
    USA300_FPR3757  TITLPKIKPSNETTSSTSIPIS
                    **********************