From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005925000
  • symbol?: narI
  • description?: nitrate reductase subunit gamma

      descriptions from strain specific annotations:

    • nitrate reductase subunit gamma
    • nitrate reductase gamma chain
    • respiratory nitrate reductase subunit gamma
    • Respiratory nitrate reductase gamma chain
    • respiratory nitrate reductase, gamma subunit
    • nitrate reductase gamma subunit
    • putative nitrate reductase gamma chain
  • strand?: -
  • coordinates?: 5989094..5989771
  • synteny block?: BlockID0046690
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2392 (narI)
    N315:
    SA2182 (narI)
    NCTC8325:
    Newman:
    NWMN_2294 (narI)
    USA300_FPR3757:
    04-02981:
    SA2981_2331 (narI)
    08BA02176:
    C248_2441 (narI)
    11819-97:
    MS7_2409 (narI)
    71193:
    ST398NM01_2447
    ECT-R 2:
    ECTR2_2253 (narI)
    ED133:
    SAOV_2439c
    ED98:
    SAAV_2459 (narI)
    HO 5096 0412:
    SAEMRSA15_22930 (narI)
    JH1:
    SaurJH1_2466
    JH9:
    SaurJH9_2418
    JKD6008:
    SAA6008_02435 (narI)
    JKD6159:
    SAA6159_02295 (narI)
    LGA251:
    SARLGA251_21760 (narI)
    M013:
    M013TW_2355
    MRSA252:
    SAR2483 (narI)
    MSHR1132:
    SAMSHR1132_22220
    MSSA476:
    SAS2285
    Mu3:
    SAHV_2378 (narI)
    Mu50:
    SAV2394 (narI)
    MW2:
    MW2316 (narI)
    RF122:
    SAB2273c (narI)
    ST398:
    SAPIG2447 (narI)
    T0131:
    SAT0131_02585
    TCH60:
    HMPREF0772_10793 (narI)
    TW20:
    SATW20_25240 (narI)
    USA300_TCH1516:
    USA300HOU_2376 (narI)
    VC40:
    SAVC_10840

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLNQFLWVIFPYLCLVVFVAGHIARYRYDKFSWTAKSSELIERKRLMWGSLLFHLGIIPV
    N315            MLNQFLWVIFPYLCLVVFVAGHIARYRYDKFSWTAKSSELIERKRLMWGSLLFHLGIIPV
    NCTC8325        MLNQFLWVIFPYLCLVVFVAGHIARYRYDKFSWTAKSSELIERKRLMWGSLLFHLGIIPV
    Newman          MLNQFLWVIFPYLCLVVFVAGHIARYRYDKFSWTAKSSELIERKRLMWGSLLFHLGIIPV
    USA300_FPR3757  MLNQFLWVIFPYLCLVVFVAGHIARYRYDKFSWTAKSSELIERKRLMWGSLLFHLGIIPV
                    ************************************************************

    COL             FFGHVVGLLIPKPWMDAVGVSEHLYHIGAVYIGSIFGIITLIGMFLLTARRVTTKSIRRL
    N315            FFGHVVGLLIPKSWMDAVGVSEHLYHIGAVYIGSIFGIITLIGMFLLTARRVTTKSIRRL
    NCTC8325        FFGHVVGLLIPKPWMDAVGVSEHLYHIGAVYIGSIFGIITLIGMFLLTARRVTTKSIRRL
    Newman          FFGHVVGLLIPKPWMDAVGVSEHLYHIGAVYIGSIFGIITLIGMFLLTARRVTTKSIRRL
    USA300_FPR3757  FFGHVVGLLIPKPWMDAVGVSEHLYHIGAVYIGSIFGIITLIGMFLLTARRVTTKSIRRL
                    ************.***********************************************

    COL             SSASDIFVNFLLLLIVFMGCYATLVTNIQHPDFNYRTSLSIWFRQLFMLKPDASLMSGVP
    N315            SSASDIFVNFLLLLIVFMGCYATLVTNIQHPDFNYRTSLSIWFRQLFMLKPDASLMSGVP
    NCTC8325        SSASDIFVNFLLLLIVFMGCYATLVTNIQHPDFNYRTSLSIWFRQLFMLKPDASLMSGVP
    Newman          SSASDIFVNFLLLLIVFMGCYATLVTNIQHPDFNYRTSLSIWFRQLFMLKPDASLMSGVP
    USA300_FPR3757  SSASDIFVNFLLLLIVFMGCYATLVTNIQHPDFNYRTSLSIWFRQLFMLKPDASLMSGVP
                    ************************************************************

    COL             IAFKMHILLGFTIMACWPFTRLVHVWSVPLTYINRRYIIYRKNKV
    N315            IAFKMHILLGFTIMACWPFTRLVHVWSVPLTYINRRYIIYRKNKV
    NCTC8325        IAFKMHILLGFTIMACWPFTRLVHVWSVPLTYINRRYIIYRKNKV
    Newman          IAFKMHILLGFTIMACWPFTRLVHVWSVPLTYINRRYIIYRKNKV
    USA300_FPR3757  IAFKMHILLGFTIMACWPFTRLVHVWSVPLTYINRRYIIYRKNKV
                    *********************************************