From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005932000
  • symbol?: nasD
  • description?: nitrite reductase large subunit

      descriptions from strain specific annotations:

    • nitrite reductase large subunit
    • nitrite reductase [NAD(P)H], large subunit
    • nitrite reductase
    • assimilatory nitrite reductase [NAD(P)H] large subunit
    • assimilatory nitrite reductase [NAD(P)H], large subunit
    • nitrite reductase (NAD(P)H) large subunit
    • nitrite reductase, large subunit
    • Nitrite reductase [NAD(P)H] large subunit
  • strand?: -
  • coordinates?: 5997445..5999850
  • synteny block?: BlockID0046760
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2398 (nirB)
    N315:
    SA2188 (nasD)
    NCTC8325:
    Newman:
    NWMN_2300 (nirB)
    USA300_FPR3757:
    04-02981:
    SA2981_2337 (nasD)
    08BA02176:
    C248_2447 (nasD)
    11819-97:
    MS7_2415 (nirB)
    71193:
    ST398NM01_2453
    ECT-R 2:
    ECTR2_2259 (nirB)
    ED133:
    SAOV_2446c
    ED98:
    SAAV_2465 (nirB)
    HO 5096 0412:
    SAEMRSA15_22990 (nasD)
    JH1:
    SaurJH1_2472
    JH9:
    SaurJH9_2424
    JKD6008:
    SAA6008_02441 (nirB)
    JKD6159:
    SAA6159_02301 (nirB)
    LGA251:
    SARLGA251_21820 (nasD)
    M013:
    M013TW_2361
    MRSA252:
    SAR2489 (nasD)
    MSHR1132:
    SAMSHR1132_22280
    MSSA476:
    SAS2291
    Mu3:
    SAHV_2384 (nasD)
    Mu50:
    SAV2400 (nasD)
    MW2:
    MW2322 (nasD)
    RF122:
    SAB2280c (nasD)
    ST398:
    SAPIG2453 (nirB)
    T0131:
    SAT0131_02591 (carB)
    TCH60:
    HMPREF0772_10787 (nirB)
    TW20:
    SATW20_25300 (nasD)
    USA300_TCH1516:
    USA300HOU_2382 (nirB)
    VC40:
    SAVC_10870

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKQKLVMIGNGMAGIRTIEEILERANDLYDITVIGKEPYPNYNRIMLSNILQNKMTVEE
    N315            MAKQKLVMIGNGMAGIRTIEEILERANDLYDITVIGKEPYPNYNRIMLSNILQNKMTVEE
    NCTC8325        MAKQKLVMIGNGMAGIRTIEEILERANDLYDITVIGKEPYPNYNRIMLSNILQNKMTVEE
    Newman          MAKQKLVMIGNGMAGIRTIEEILERANDLYDITVIGKEPYPNYNRIMLSNILQNKMTVEE
    USA300_FPR3757  MAKQKLVMIGNGMAGIRTIEEILERANDLYDITVIGKEPYPNYNRIMLSNILQNKMTVEE
                    ************************************************************

    COL             TIMNPYEWYEEHGIELITNDPVIEVDRANQSVTTANGIEVSYDKLIFATGSKAFVIPVPG
    N315            TIMNPYEWYEEHGIELITNDPVIEVDRANQSVTTANGIEVSYDKLIFATGSKAFVIPVPG
    NCTC8325        TIMNPYEWYEEHGIELITNDPVIEVDRANQSVTTANGIEVSYDKLIFATGSKAFVIPVPG
    Newman          TIMNPYEWYEEHGIELITNDPVIEVDRANQSVTTANGIEVSYDKLIFATGSKAFVIPVPG
    USA300_FPR3757  TIMNPYEWYEEHGIELITNDPVIEVDRANQSVTTANGIEVSYDKLIFATGSKAFVIPVPG
                    ************************************************************

    COL             STLPSVIGWRTIDDTEQMMNIAKTKKKAIVIGGGLLGLECARGLLDQGMEVTVLHLAEWL
    N315            STLPSVIGWRTIDDTEQMMNIAKTKKKAIVIGGGLLGLECARGLLDQGMEVTVLHLAEWL
    NCTC8325        STLPSVIGWRTIDDTEQMMNIAKTKKKAIVIGGGLLGLECARGLLDQGMEVTVLHLAEWL
    Newman          STLPSVIGWRTIDDTEQMMNIAKTKKKAIVIGGGLLGLECARGLLDQGMEVTVLHLAEWL
    USA300_FPR3757  STLPSVIGWRTLDDTEQMMNIAKTKKKAIVIGGGLLGLECARGLLDQGMEVTVLHLAEWL
                    ***********:************************************************

    COL             MEMQLDRKAGNMLKADLEKQGMKFEMQANTTEILGEDDVEGVKLADGREIPADLVVMAVG
    N315            MEMQLDRKAGNMLKADLEKQGMKFEMQANTTEILGEDDVEGVKLADGREIPADLVVMAVG
    NCTC8325        MEMQLDRKAGNMLKADLEKQGMKFEMQANTTEILGEDDVEGVKLADGREIPADLVVMAVG
    Newman          MEMQLDRKAGNMLKADLEKQGMKFEMQANTTEILGEDDVEGVKLADGREIPADLVVMAVG
    USA300_FPR3757  MEMQLDRKAGNMLKADLEKQGMKFEMQANTTEILGEDDVEGVKLADGREIPADLVVMAVG
                    ************************************************************

    COL             IRPYTEVAKESGLDVNRGIVVNDVMQTSDSNVYAVGECAEHNGKVYGLVAPLYEQGKVLA
    N315            IRPYTEVAKESGLDVNRGIVVNDVMQTSDSNVYAVGECAEHNGKVYGLVAPLYEQGKVLA
    NCTC8325        IRPYTEVAKESGLDVNRGIVVNDVMQTSDSNVYAVGECAEHNGKVYGLVAPLYEQGKVLA
    Newman          IRPYTEVAKESGLDVNRGIVVNDVMQTSDSNVYAVGECAEHNGKVYGLVAPLYEQGKVLA
    USA300_FPR3757  IRPYTEVAKESGLDVNRGIVVNDVMQTSDSNVYAVGECAEHNGKVYGLVAPLYEQGKVLA
                    ************************************************************

    COL             DHLTNKETNGYKGSTTFTSLKVSGCDLYSAGQIVENAEIKGIEIFNSVDNNYKKIFLKDG
    N315            DHLTNKETNGYKGSTTFTSLKVSGCDLYSAGQIVENAEIKGIEIFNSVDNNYKKIFLKDG
    NCTC8325        DHLTNKETNGYKGSTTFTSLKVSGCDLYSAGQIVENAEIKGIEIFNSVDNNYKKIFLKDG
    Newman          DHLTNKETNGYKGSTTFTSLKVSGCDLYSAGQIVENAEIKGIEIFNSVDNNYKKIFLKDG
    USA300_FPR3757  DHLTNKETNGYKGSTTFTSLKVSGCDLYSAGQIVENAEIKGIEIFNSVDNNYKKIFLKDG
                    ************************************************************

    COL             NVVGAVLYGDIDDGSRFYNMMKKGESTEDYTLVSLLTKGGEEASLSIADMADDETICGCN
    N315            NVVGAVLYGDIDDGSRFYNMMKKGESTEDYTLVSLLTKGGEEASLSIADMADDETICGCN
    NCTC8325        NVVGAVLYGDIDDGSRFYNMMKKGESTEDYTLVSLLTKGGEEASLSIADMADDETICGCN
    Newman          NVVGAVLYGDIDDGSRFYNMMKKGESTEDYTLVSLLTKGGEEASLSIADMADDETICGCN
    USA300_FPR3757  NVVGAVLYGDIDDGSRFYNMMKKGESTEDYTLVSLLTKGGEEASLSIADMADDETICGCN
                    ************************************************************

    COL             GVDKGTIVNAITENGFTTVEEVTAKTKAGNSCGKCKPQIAQILQHTLGDDFVAAKPAGIC
    N315            GVDKGTIVNAITENGFTTVEEVTAKTKAGNSCGKCKPQIAQILQHTLGDDFVAAKPAGIC
    NCTC8325        GVDKGTIVNAITENGFTTVEEVTAKTKAGNSCGKCKPQIAQILQHTLGDDFVAAKPAGIC
    Newman          GVDKGTIVNAITENGFTTVEEVTAKTKAGNSCGKCKPQIAQILQHTLGDDFVAAKPAGIC
    USA300_FPR3757  GVDKGTIVNAITENGFTTVEEVTAKTKAGNSCGKCKPQIAQILQHTLGDDFVAAKPAGIC
                    ************************************************************

    COL             GCTDLTRDQIVTQIRAKGLKTSKEVRHVLNFKNKGGCPKCRPAINYYLNMVYPHDHEDER
    N315            GCTDLTRDQIVTQIRAKGLKTSKEVRHVLNFKNKGGCPKCRPAINYYLNMVYPHDHEDER
    NCTC8325        GCTDLTRDQIVTQIRAKGLKTSKEVRHVLNFKNKGGCPKCRPAINYYLNMVYPHDHEDER
    Newman          GCTDLTRDQIVTQIRAKGLKTSKEVRHVLNFKNKGGCPKCRPAINYYLNMVYPHDHEDER
    USA300_FPR3757  GCTDLTRDQIVTQIRAKGLKTSKEVRHVLNFKNKGGCPKCRPAINYYLNMVYPHDHEDER
                    ************************************************************

    COL             ESRFANERYHANIQNDGTFSVIPQMRGGVTDADQLIRLGEVAKKYHVPLVKVTGSQRVGL
    N315            ESRFANERYHANIQNDGTFSVIPQMRGGVTDADQLIRLGEVAKKYHVPLVKVTGSQRVGL
    NCTC8325        ESRFANERYHANIQNDGTFSVIPQMRGGVTDADQLIRLGEVAKKYHVPLVKVTGSQRVGL
    Newman          ESRFANERYHANIQNDGTFSVIPQMRGGVTDADQLIRLGEVAKKYHVPLVKVTGSQRVGL
    USA300_FPR3757  ESRFANERYHANIQNDGTFSVIPQMRGGVTDADQLIRLGEVAKKYHVPLVKVTGSQRVGL
                    ************************************************************

    COL             YGVKKEELPNIWEDLGMRSASAYGKKTRSVKSCVGKEFCRFGTQYTTRLGIRLEKTFEYI
    N315            YGVKKEELPNIWEDLGMRSASAYGKKTRSVKSCVGKEFCRFGTQYTTRLGIRLEKTFEYI
    NCTC8325        YGVKKEELPNIWEDLGMRSASAYGKKTRSVKSCVGKEFCRFGTQYTTRLGIRLEKTFEYI
    Newman          YGVKKEELPNIWEDLGMRSASAYGKKTRSVKSCVGKEFCRFGTQYTTRLGIRLEKTFEYI
    USA300_FPR3757  YGVKKEELPNIWEDLGMRSASAYGKKTRSVKSCVGKEFCRFGTQYTTRLGIRLEKTFEYI
                    ************************************************************

    COL             DTPHKFKMGVSGCPRSCVESGVKDFGIISVENGFQIYIGGNGGTEVEKAEFLTTVETEDE
    N315            DTPHKFKMGVSGCPRSCVESGVKDFGIISVENGFQIYIGGNGGTEVEKAEFLTTVETEDE
    NCTC8325        DTPHKFKMGVSGCPRSCVESGVKDFGIISVENGFQIYIGGNGGTEVEKAEFLTTVETEDE
    Newman          DTPHKFKMGVSGCPRSCVESGVKDFGIISVENGFQIYIGGNGGTEVEKAEFLTTVETEDE
    USA300_FPR3757  DTPHKFKMGVSGCPRSCVESGVKDFGIISVENGFQIYIGGNGGTEVEKAEFLTTVETEDE
                    ************************************************************

    COL             VIKLCGALMQYYRETGIYAERTAPWLRRLGFENVKEVLLDPERQNELFERIMDAKKAVEA
    N315            VIKLCGALMQYYRETGIYAERTAPWLRRLGFENVKEVLLDPERQNELFERIMDAKKAVEA
    NCTC8325        VIKLCGALMQYYRETGIYAERTAPWLRRLGFENVKEVLLDPERQNELFERIMDAKKAVEA
    Newman          VIKLCGALMQYYRETGIYAERTAPWLRRLGFENVKEVLLDPERQNELFERIMDAKKAVEA
    USA300_FPR3757  VIKLCGALMQYYRETGIYAERTAPWLRRLGFENVKEVLLDPERQNELFERIMDAKKAVEA
                    ************************************************************

    COL             EPWEAITSNAQARRIFEVEKV
    N315            EPWEAITSNAQARKIFEVEKV
    NCTC8325        EPWEAITSNAQARRIFEVEKV
    Newman          EPWEAITSNAQARRIFEVEKV
    USA300_FPR3757  EPWEAITSNAQARRIFEVEKV
                    *************:*******