From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005935000
  • symbol?:
  • description?: formate/nitrite transporter

      descriptions from strain specific annotations:

    • formate/nitrite transporter
    • formate/nitrite transporter family protein
    • FNT family formate-nitrite transporter
    • formate-nitrite transporter
    • putative nitrite transporter
  • strand?: -
  • coordinates?: 6002109..6002816
  • synteny block?: BlockID0046790
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2340 (nirC)
    08BA02176:
    C248_2450
    11819-97:
    MS7_2418
    71193:
    ST398NM01_2456
    ECT-R 2:
    ECTR2_2262
    ED133:
    SAOV_2449c
    ED98:
    SAAV_2468
    HO 5096 0412:
    SAEMRSA15_23020
    JH1:
    SaurJH1_2475
    JH9:
    SaurJH9_2427
    JKD6008:
    SAA6008_02444
    JKD6159:
    SAA6159_02304
    LGA251:
    SARLGA251_21850
    M013:
    M013TW_2364
    MRSA252:
    SAR2493
    MSHR1132:
    SAMSHR1132_22310
    MSSA476:
    SAS2294
    Mu3:
    SAHV_2387
    Mu50:
    SAV2403
    MW2:
    MW2325
    RF122:
    SAB2283c
    ST398:
    SAPIG2456
    T0131:
    SAT0131_02594
    TCH60:
    HMPREF0772_10784
    TW20:
    SATW20_25330
    USA300_TCH1516:
    USA300HOU_2385
    VC40:
    SAVC_10885

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIENKKTVEDTYSTGAIVDSISSSVQMKQVMVQQTPGRYMLKAMMAGFLLSIVTVFMFGI
    N315            MIENKKTVEDTYSTGAIVDSISSSVQMKQVMVQQTPGRYMLKAMMAGFLLSIVTVFMFGI
    NCTC8325        MIENKKTVEDTYSTGAIVDSISSSVQMKQVMVQQTPGRYMLKAMMAGFLLSIVTVFMFGI
    Newman          MIENKKTVEDTYSTGAIVDSISSSVQMKQVMVQQTPGRYMLKAMMAGFLLSIVTVFMFGI
    USA300_FPR3757  MIENKKTVEDTYSTGAIVDSISSSVQMKQVMVQQTPGRYMLKAMMAGFLLSIVTVFMFGI
                    ************************************************************

    COL             KTQFASTHVDGLINLMGAIAFSLGLILVVLTNSELLTSNFMYFTVGWYYKVVSVKKMTWI
    N315            KTQFANTHVDGLINLMGAIAFSLGLILVVLTNSELLTSNFMYFTVGWYYKVVSVKKMTWI
    NCTC8325        KTQFASTHVDGLINLMGAIAFSLGLILVVLTNSELLTSNFMYFTVGWYYKVVSVKKMTWI
    Newman          KTQFASTHVDGLINLMGAIAFSLGLILVVLTNSELLTSNFMYFTVGWYYKVVSVKKMTWI
    USA300_FPR3757  KTQFASTHVDGLINLMGAIAFSLGLILVVLTNSELLTSNFMYFTVGWYYKVVSVKKMTWI
                    *****.******************************************************

    COL             LLYCFLGNILGGFVLFFLMKFAHVMTPEMTQALTALVQKKTVDSTWLNIFTKGIFCNFFI
    N315            LLYCFLGNILGGFVLFFLMKFAHVMTPEMTQALTALVQKKTVDSTWLNIFTKGIFCNFFI
    NCTC8325        LLYCFLGNILGGFVLFFLMKFAHVMTPEMTQALTALVQKKTVDSTWLNIFTKGIFCNFFI
    Newman          LLYCFLGNILGGFVLFFLMKFAHVMTPEMTQALTALVQKKTVDSTWLNIFTKGIFCNFFI
    USA300_FPR3757  LLYCFLGNILGGFVLFFLMKFAHVMTPEMTQALTALVQKKTVDSTWLNIFTKGIFCNFFI
                    ************************************************************

    COL             NIGIFISMQFKGGLTKAFFIACGVVVFVYMGYEHVVFNAGLYAGMVFFNLDAVSWLHVLK
    N315            NIGIFISMQFKGGLTKAFFIACGVVVFVYMGYEHVVFNAGLYAGMVFFNLDAVSWLHVLK
    NCTC8325        NIGIFISMQFKGGLTKAFFIACGVVVFVYMGYEHVVFNAGLYAGMVFFNLDAVSWLHVLK
    Newman          NIGIFISMQFKGGLTKAFFIACGVVVFVYMGYEHVVFNAGLYAGMVFFNLDAVSWLHVLK
    USA300_FPR3757  NIGIFISMQFKGGLTKAFFIACGVVVFVYMGYEHVVFNAGLYAGMVFFNLDAVSWLHVLK
                    ************************************************************

    COL             NIVFAFLGNFVGGGIFVGLVYAFLNGKRNRLEQQ
    N315            NIVFAFLGNFVGGGIFVGLVYAFLNGKRNRLEQQ
    NCTC8325        NIVFAFLGNFVGGGIFVGLVYAFLNGKRNRLEQQ
    Newman          NIVFAFLGNFVGGGIFVGLVYAFLNGKRNRLEQQ
    USA300_FPR3757  NIVFAFLGNFVGGGIFVGLVYAFLNGKRNRLEQQ
                    **********************************