From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005937000
  • symbol?:
  • description?: glutathione S-transferase

      descriptions from strain specific annotations:

    • glutathione S-transferase
    • activator of Hsp90 ATPase 1 family protein
    • activator of Hsp90 ATPase1-like protein
    • activator of Hsp90 ATPase family protein
    • glutathione S-transferase-related transmembrane protein
    • putative glutathione S-transferase-related transmembrane protein
  • strand?: -
  • coordinates?: 6003427..6003894
  • synteny block?: BlockID0046810
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2342
    08BA02176:
    C248_2452
    11819-97:
    MS7_2420
    71193:
    ST398NM01_2458
    ECT-R 2:
    ECTR2_2264
    ED133:
    SAOV_2451c
    ED98:
    SAAV_2470
    HO 5096 0412:
    SAEMRSA15_23040
    JH1:
    SaurJH1_2477
    JH9:
    SaurJH9_2429
    JKD6008:
    SAA6008_02446
    JKD6159:
    SAA6159_02306
    LGA251:
    SARLGA251_21870
    M013:
    M013TW_2366
    MRSA252:
    SAR2495
    MSHR1132:
    SAMSHR1132_22330
    MSSA476:
    SAS2296
    Mu3:
    SAHV_2389
    Mu50:
    SAV2405
    MW2:
    MW2327
    RF122:
    SAB2285c
    ST398:
    SAPIG2458
    T0131:
    SAT0131_02596
    TCH60:
    HMPREF0772_10782
    TW20:
    SATW20_25350
    USA300_TCH1516:
    VC40:
    SAVC_10895

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTIKVEDNKIIFSRTIEAPIEKVFDAYTTKALFEKWFHPKDASTKVFRFNAVSGGDAFYA
    N315            MTIKVEDNKIIFSRTIEAPIEKVFDAYTTKELFEKWFHPKGASTKVFRFNAVSGGDAFYA
    NCTC8325        MTIKVEDNKIIFSRTIEAPIEKVFDAYTTKALFEKWFHPKDASTKVFRFNAVSGGDAFYA
    Newman          MTIKVEDNKIIFSRTIEAPIEKVFDAYTTKALFEKWFHPKDASTKVFRFNAVSGGDAFYA
    USA300_FPR3757  MTIKVEDNKIIFSRTIEAPIEKVFDAYTTKALFEKWFHPKDASTKVFRFNAVSGGDAFYA
                    ****************************** *********.*******************

    COL             IKTPTMTSYTLAEYKTVKRPYLIEYIDSFATPQGAKDTKMPSMKITLSFSKSNTTKTTVT
    N315            IKTPTMTSYTLAEYKTVKRPYLIEYIDSFATPQGAKDTKMPSMKITLSFSKSNTTKTTVT
    NCTC8325        IKTPTMTSYTLAEYKTVKRPYLIEYIDSFATPQGAKDTKMPSMKITLSFSKSNTTKTTVT
    Newman          IKTPTMTSYTLAEYKTVKRPYLIEYIDSFATPQGAKDTKMPSMKITLSFSKSNTTKTTVT
    USA300_FPR3757  IKTPTMTSYTLAEYKTVKRPYLIEYIDSFATPQGAKDTKMPSMKITLSFSKSNTTKTTVT
                    ************************************************************

    COL             STSVFPTKEAAQQVINMGVEQGMNQTLDQLDALLK
    N315            STSVFPTKEAAQQVINMGVEQGMNQTLDQLDALLK
    NCTC8325        STSVFPTKEAAQQVINMGVEQGMNQTLDQLDALLK
    Newman          STSVFPTKEAAQQVINMGVEQGMNQTLDQLDALLK
    USA300_FPR3757  STSVFPTKEAAQQVINMGVEQGMNQTLDQLDALLK
                    ***********************************