From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005939000
  • symbol?:
  • description?: addiction module antitoxin

      descriptions from strain specific annotations:

    • addiction module antitoxin
    • addiction module toxin Txe/YoeB family protein
    • addiction module, toxin
    • txe/YoeB family addiction module toxin
    • pseudogene
  • strand?: -
  • coordinates?: 6005971..6006237
  • synteny block?: BlockID0046830
  • occurrence?: in 91% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2344
    08BA02176:
    11819-97:
    MS7_2422
    71193:
    ECT-R 2:
    ECTR2_2266
    ED133:
    SAOV_2453c
    ED98:
    SAAV_2472
    HO 5096 0412:
    SAEMRSA15_23060
    JH1:
    SaurJH1_2479
    JH9:
    SaurJH9_2431
    JKD6008:
    SAA6008_02448
    JKD6159:
    SAA6159_02308
    LGA251:
    SARLGA251_21890
    M013:
    M013TW_2368
    MRSA252:
    SAR2497
    MSHR1132:
    SAMSHR1132_22350
    MSSA476:
    SAS2298
    Mu3:
    SAHV_2391
    Mu50:
    SAV2407
    MW2:
    MW2329
    RF122:
    SAB2287c
    ST398:
    T0131:
    SAT0131_02598 (gmk)
    TCH60:
    HMPREF0772_10780
    TW20:
    SATW20_25370
    USA300_TCH1516:
    USA300HOU_2387
    VC40:
    SAVC_10905

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MARLNITFSPQAFEDYKYFQQNDKKMVKKINELLKSIDRNGALEGIGKPEKLKSNLTGYY
    N315            MARLNITFSPQAFEDYKYFQQNNKKMVKKINELLKSIDRNGALEGIGKPEKLKSNLTGYY
    NCTC8325        MARLNITFSPQAFEDYKYFQQNDKKMVKKINELLKSIDRNGALEGIGKPEKLKSNLTGYY
    Newman          MARLNITFSPQAFEDYKYFQQNDKKMVKKINELLKSIDRNGALEGIGKPEKLKSNLTGYY
    USA300_FPR3757  MARLNITFSPQAFEDYKYFQQNDKKMVKKINELLKSIDRNGALEGIGKPEKLKSNLTGYY
                    **********************:*************************************

    COL             SRRINHEHRLVYTVDDNHIKIASCKYHY
    N315            SRRINHEHRLVYTVDDNHIKIASCKYHY
    NCTC8325        SRRINHEHRLVYTVDDNHIKIASCKYHY
    Newman          SRRINHEHRLVYTVDDNHIKIASCKYHY
    USA300_FPR3757  SRRINHEHRLVYTVDDNHIKIASCKYHY
                    ****************************