From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan005945000
  • symbol?: fmhA
  • description?: fmhA protein

      descriptions from strain specific annotations:

    • fmhA protein
    • methicillin resistance protein
    • FmhA protein of FemAB family
    • femAB family protein
    • methicillin resistance determinant fmhA protein
    • FemAB family peptidoglycan biosynthesis protein
    • aminoacyltransferase femA
    • lysostaphin endopeptidase resistance protein
    • aminoacyltransferase FemA (Factor essential forexpression of methicillin resistance A)
    • UDP-N-acetylmuramoylheptapeptide-glycine L-seryltransferase
    • pseudogene
  • strand?: +
  • coordinates?: 6008897..6010147
  • synteny block?: BlockID0046890
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2409 (fmhA)
    N315:
    SA2199 (fmhA)
    NCTC8325:
    Newman:
    NWMN_2310 (fmhA)
    USA300_FPR3757:
    04-02981:
    SA2981_2348 (fmhA)
    08BA02176:
    C248_2456 (fmhA)
    11819-97:
    MS7_2426
    71193:
    ST398NM01_2462
    ECT-R 2:
    ECTR2_2270
    ED133:
    SAOV_2457
    ED98:
    SAAV_2476 (fmhA)
    HO 5096 0412:
    SAEMRSA15_23100 (fmhA)
    JH1:
    SaurJH1_2484
    JH9:
    SaurJH9_2436
    JKD6008:
    SAA6008_02452 (fmhA)
    JKD6159:
    SAA6159_02312 (fmhA)
    LGA251:
    SARLGA251_21930 (fmhA)
    M013:
    M013TW_2372
    MRSA252:
    SAR2501 (fmhA)
    MSHR1132:
    SAMSHR1132_22390
    MSSA476:
    SAS2302
    Mu3:
    SAHV_2395 (fmhA)
    Mu50:
    SAV2411 (fmhA)
    MW2:
    MW2333 (fmhA)
    RF122:
    SAB2291 (fmhA)
    ST398:
    SAPIG2462
    T0131:
    SAT0131_02602
    TCH60:
    HMPREF0772_10776 (fmhA)
    TW20:
    SATW20_25410 (fmhA)
    USA300_TCH1516:
    USA300HOU_2392
    VC40:
    SAVC_10925

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNFVTLTSDEFNAFTTKHFSHYTQSAIHYNHRVDLKGDVHLVGVKDDNGQVIAGCLLTEA
    N315            MNFVTLTSDEFNAFTTKHFSHYTQSAIHYNHRVDLKGDVHLVGVKDDNGQVIAGCLLTEA
    NCTC8325        MNFVTLTSDEFNAFTTKHFSHYTQSAIHYNHRVDLKGDVHLVGVKDDNGQVIAGCLLTEA
    Newman          MNFVTLTSDEFNAFTTKHFSHYTQSAIHYNHRVDLKGDVHLVGVKDDNGQVIAGCLLTEA
    USA300_FPR3757  MNFVTLTSDEFNAFTTKHFSHYTQSAIHYNHRVDLKGDVHLVGVKDDNGQVIAGCLLTEA
                    ************************************************************

    COL             RTLKFFKYFYTHRGPVMDYTNQSLVAFFFKALTSYLKKHNCLYVLVDPYLIENLRNADGE
    N315            RTLKFFKYFYTHRGPVMDYTNQSLVAFFFKALTSYLKKHNCLYVLVDPYLIENLRNADGE
    NCTC8325        RTLKFFKYFYTHRGPVMDYTNQSLVAFFFKALTSYLKKHNCLYVLVDPYLIENLRNADGE
    Newman          RTLKFFKYFYTHRGPVMDYTNQSLVAFFFKALTSYLKKHNCLYVLVDPYLIENLRNADGE
    USA300_FPR3757  RTLKFFKYFYTHRGPVMDYTNQSLVAFFFKALTSYLKKHNCLYVLVDPYLIENLRNADGE
                    ************************************************************

    COL             IVKSYDNRAFVRTMDKLGYKHQGFPVGYDSMSQIRWLSVLDLKDKTEDQLLKEMDYQTRR
    N315            IVKSYDNRAFVRTMDKLGYKHQGFPVGYDSMSQIRWLSVLDLKDKTEDQLLKEMDYQTRR
    NCTC8325        IVKSYDNRAFVRTMDKLGYKHQGFPVGYDSMSQIRWLSVLDLKDKTEDQLLKEMDYQTRR
    Newman          IVKSYDNRAFVRTMDKLGYKHQGFPVGYDSMSQIRWLSVLDLKDKTEDQLLKEMDYQTRR
    USA300_FPR3757  IVKSYDNRAFVRTMDKLGYKHQGFPVGYDSMSQIRWLSVLDLKDKTEDQLLKEMDYQTRR
                    ************************************************************

    COL             NIKKTYDIGVKTKTLTIDETQTFFDLFHMAEEKHGFKFRELPYFEEMQKLYDDHAMLKLA
    N315            NIKKTYDIGVKTKTLTIDETQTFFDLFHMAEEKHGFKFRELPYFEEMQKLYDDHAMLKLA
    NCTC8325        NIKKTYDIGVKTKTLTIDETQTFFDLFHMAEEKHGFKFRELPYFEEMQKLYDDHAMLKLA
    Newman          NIKKTYDIGVKTKTLTIDETQTFFDLFHMAEEKHGFKFRELPYFEEMQKLYDDHAMLKLA
    USA300_FPR3757  NIKKTYDIGVKTKTLTIDETQTFFDLFHMAEEKHGFKFRELPYFEEMQKLYDDHAMLKLA
                    ************************************************************

    COL             YIDLNEYLKTLQLKQQQLTAELSGVEEALEESPNSKKNKTKRTQLEQQLNSNKRKIDNTI
    N315            YIDLNEYLKTLQLKQQQLTAELSGVEEALEESPNSKKNKTKRTQLEQQLNSNKRKIDNTI
    NCTC8325        YIDLNEYLKTLQLKQQQLTAELSGVEEALEESPNSKKNKTKRTQLEQQLNSNKRKIDNTI
    Newman          YIDLNEYLKTLQLKQQQLTAELSGVEEALEESPNSKKNKTKRTQLEQQLNSNKRKIDNTI
    USA300_FPR3757  YIDLNEYLKTLQLKQQQLTAELSGVEEALEESPNSKKNKTKRTQLEQQLNSNKRKIDNTI
                    ************************************************************

    COL             EQIEQDGAVLNLASALFIYNEHEVYYLSSGSNPKYNAYMGAYHLQWEMIKFAKAHHIDRY
    N315            EQIEQDGAVLNLASALFIYNEHEVYYLSSGSNPKYNAYMGAYHLQWEMIKFAKAHHIDRY
    NCTC8325        EQIEQDGAVLNLASALFIYNEHEVYYLSSGSNPKYNAYMGAYHLQWEMIKFAKAHHIDRY
    Newman          EQIEQDGAVLNLASALFIYNEHEVYYLSSGSNPKYNAYMGAYHLQWEMIKFAKAHHIDRY
    USA300_FPR3757  EQIEQDGAVLNLASALFIYNEHEVYYLSSGSNPKYNAYMGAYHLQWEMIKFAKAHHIDRY
                    ************************************************************

    COL             NFYGITGDFSESSEDYGVQQFKKGFNAHVEEYIGDFIKPIKPLLYKVQTYLNHKRR
    N315            NFYGITGDYSESSEDYGVQQFKKGFNAHVEEYIGDFIKPIKPLLYKVQTYLNHKRR
    NCTC8325        NFYGITGDFSESSEDYGVQQFKKGFNAHVEEYIGDFIKPIKPLLYKVQTYLNHKRR
    Newman          NFYGITGDFSESSEDYGVQQFKKGFNAHVEEYIGDFIKPIKPLLYKVQTYLNHKRR
    USA300_FPR3757  NFYGITGDFSESSEDYGVQQFKKGFNAHVEEYIGDFIKPIKPLLYKVQTYLNHKRR
                    ********:***********************************************