From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005949000
  • symbol?: mdeA
  • description?: multidrug resistance protein YcnB

      descriptions from strain specific annotations:

    • multidrug resistance protein YcnB
    • EmrB/QacA family drug resistance transporter
    • drug resistance MFS transporter, drug:H+ antiporter-1 (14 Spanner) (DHA2) family protein
    • H+ antiporter-2 family protein
    • major facilitator superfamily multidrug :cation symporter
    • MFS family major facilitator transporter, multidrug :cation symporter
    • drug resistance transporter EmrB/QacA subfamily protein
    • putative transport system protein
    • multidrug resistanc-related transport system protein
    • lincomycin resistance protein LmrB
    • multidrug resistance protein B
  • strand?: -
  • coordinates?: 6012572..6013930
  • synteny block?: BlockID0046930
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2352
    08BA02176:
    C248_2460
    11819-97:
    MS7_2430
    71193:
    ST398NM01_2466
    ECT-R 2:
    ECTR2_2274
    ED133:
    SAOV_2461c
    ED98:
    SAAV_2480
    HO 5096 0412:
    SAEMRSA15_23140
    JH1:
    SaurJH1_2488
    JH9:
    SaurJH9_2440
    JKD6008:
    SAA6008_02456
    JKD6159:
    SAA6159_02316
    LGA251:
    SARLGA251_21970
    M013:
    M013TW_2376
    MRSA252:
    SAR2505
    MSHR1132:
    SAMSHR1132_22430
    MSSA476:
    SAS2306
    Mu3:
    SAHV_2399
    Mu50:
    SAV2415
    MW2:
    MW2337
    RF122:
    SAB2295c
    ST398:
    SAPIG2466
    T0131:
    SAT0131_02606 (fmt)
    TCH60:
    HMPREF0772_10772 (lmrB2)
    TW20:
    SATW20_25450
    USA300_TCH1516:
    USA300HOU_2396
    VC40:
    SAVC_10945

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --------------MGGFFGLLNETLLVTALPSIMKDFEISYTQVQWLTTAFLLTNGIVI
    N315            MSKKQKLTMIITMLMGGFFGLLNETLLVTALPSIMKDFEISYTQVQWLTTAFLLTNGIVI
    NCTC8325        ---------------------------MTALPSIMKDFEISYTQVQWLTTAFLLTNGIVI
    Newman          ---------------------------MTAYPSIMKDFEISYTQVQWLTTAFLLTNGIVI
    USA300_FPR3757  ---------------------------MTALPSIMKDFEISYTQVQWLTTAFLLTNGIVI
                                               :** *****************************

    COL             PLSALVIQRYTTRQVFLVGISIFFLGTLLGGLSPHFATLLVARIIQALGAGIMMPLMMTT
    N315            PLSALVIQRYTTRQVFLVGISIFFLGTLLGGLSPHFATLLVARIIQALGAGIMMPLMMTT
    NCTC8325        PLSALVIQRYTTRQVFLVGISIFFLGTLLGGLSPHFATLLVARIIQALGAGIMMPLMMTT
    Newman          PLSALVIQRYTTRQVFLVGISIFFLGTLLGGLSPHFATLLVARIIQALGAGIMMPLMMTT
    USA300_FPR3757  PLSALVIQRYTTRQVFLVGISIFFLGTLLGGLSPHFATLLVARIIQALGAGIMMPLMMTT
                    ************************************************************

    COL             ILDVFQPHERGKYMGIFGLVIGLAPAIGPTLSGYLVEYFNWRSLFHVVAPIAAVTFLIGF
    N315            ILDVFQPHERGKYMGIFGLVIGLAPAIGPTLSGYLVEYLNWRSLFHVVAPIAAVTFLIGF
    NCTC8325        ILDVFQPHERGKYMGIFGLVIGLAPAIGPTLSGYLVEYFNWRSLFHVVAPIAAVTFLIGF
    Newman          ILDVFQPHERGKYMGIFGLVIGLAPAIGPTLSGYLVEYFNWRSLFHVVAPIAAVTFLIGF
    USA300_FPR3757  ILDVFQPHERGKYMGIFGLVIGLAPAIGPTLSGYLVEYFNWRSLFHVVAPIAAVTFLIGF
                    **************************************:*********************

    COL             KTIKNVGTTIKVPIDFISVIFSVLGFGGLLYGTSSISEKGFDNPIVLVSMIGGVVLVALF
    N315            KTIKNVGTTIKVPIDFISVIFSVLGFGGLLYGTSSISEKGFDNPIVLVSMIGGVVLVALF
    NCTC8325        KTIKNVGTTIKVPIDFISVIFSVLGFGGLLYGTSSISEKGFDNPIVLVSMIGGVVLVALF
    Newman          KTIKNVGTTIKVPIDFISVIFSVLGFGGLLYGTSSISEKGFDNPIVLVSMIGGVVLVALF
    USA300_FPR3757  KTIKNVGTTIKVPIDFISVIFSVLGFGGLLYGTSSISEKGFDNPIVLVSMIGGVVLVALF
                    ************************************************************

    COL             VLRQYRLSTPLLNFAVFKNKQFTVGIIIMGVTMVSMIGSETILPIFVQNLLHRSALDSGL
    N315            VLRQYRLSTPLLNFAVFKNKQFTVGIIIMGVTMVSMIGSETILPIFVQNLLHRSALDSGL
    NCTC8325        VLRQYRLSTPLLNFAVFKNKQFTVGIIIMGVTMVSMIGSETILPIFVQNLLHRSALDSGL
    Newman          VLRQYRLSTPLLNFAVFKNKQFTVGIIIMGVTMVSMIGSETILPIFVQNLLHRSALDSGL
    USA300_FPR3757  VLRQYRLSTPLLNFAVFKNKQFTVGIIIMGVTMVSMIGSETILPIFVQNLLHRSALDSGL
                    ************************************************************

    COL             TLLPGAIVMAFMSMTSGALYEKFGPRNLALVGMAIVVITTAYFVVMDEQTSTIMLATVYA
    N315            TLLPGAIVMAFMSMTSGALYEKFGPRKLALVGMAIVVITTAYFVVMDEQTSTIMLATVYA
    NCTC8325        TLLPGAIVMAFMSMTSGALYEKFGPRNLALVGMAIVVITTAYFVVMDEQTSTIMLATVYA
    Newman          TLLPGAIVMAFMSMTSGALYEKFGPRNLALVGMAIVVITTAYFVVMDEQTSTIMLATVYA
    USA300_FPR3757  TLLPGAIVMAFMSMTSGALYEKFGPRNLALVGMAIVVITTAYFVVMDEQTSTIMLATVYA
                    **************************:*********************************

    COL             IRMVGIALGLIPVMTHTMNQLKPEMNAHGSSMTNTVQQIAGSIGTAALITILSHASKNFS
    N315            IRMVGIALGLIPVMTHTMNQLKPEMNAHGSSMTNTVQQIAGSIGTAALITILSHASKNFS
    NCTC8325        IRMVGIALGLIPVMTHTMNQLKPEMNAHGSSMTNTVQQIAGSIGTAALITILSHASKNFS
    Newman          IRMVGIALGLIPVMTHTMNQLKPEMNAHGSSMTNTVQQIAGSIGTAALITILSHASKNFS
    USA300_FPR3757  IRMVGIALGLIPVMTHTMNQLKPEMNAHGSSMTNTVQQIAGSIGTAALITILSHASKNFS
                    ************************************************************

    COL             PTMSDYNGMNKIDMMNQIKVDTMLHGYHAGFLFALLITVVSFFCSFMLQGKKKEVDSRQ
    N315            PTMSDYNGMNKIDMMNQIKVDTMLHGYHAGFLFALLITVVSFFCSFMLQGKKKEVDSRQ
    NCTC8325        PTMSDYNGMNKIDMMNQIKVDTMLHGYHAGFLFALLITVVSFFCSFMLQGKKKEVDSRQ
    Newman          PTMSDYNGMNKIDMMNQIKVDTMLHGYHAGFLFALLITVVSFFCSFMLQGKKKEVDSRQ
    USA300_FPR3757  PTMSDYNGMNKIDMMNQIKVDTMLHGYHAGFLFALLITVVSFFCSFMLQGKKKEVDSRQ
                    ***********************************************************