From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005953000
  • symbol?:
  • description?: cation transporter

      descriptions from strain specific annotations:

    • cation transporter
    • cation efflux family protein
    • cation diffusion facilitator family transporter
    • cation diffusion facilitator family transporter family protein
    • cation diffusion facilitator transporter family protein
    • CDF family cation diffusion facilitator
    • Cobalt-zinc-cadmium resistance protein
  • strand?: -
  • coordinates?: 6015468..6016334
  • synteny block?: BlockID0046970
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2354
    08BA02176:
    C248_2463
    11819-97:
    MS7_2432
    71193:
    ST398NM01_2468
    ECT-R 2:
    ECTR2_2276
    ED133:
    SAOV_2464c
    ED98:
    SAAV_2483
    HO 5096 0412:
    SAEMRSA15_23160
    JH1:
    SaurJH1_2491
    JH9:
    SaurJH9_2443
    JKD6008:
    SAA6008_02458
    JKD6159:
    SAA6159_02318
    LGA251:
    SARLGA251_21990
    M013:
    M013TW_2378
    MRSA252:
    SAR2507
    MSHR1132:
    SAMSHR1132_22460
    MSSA476:
    SAS2308
    Mu3:
    SAHV_2401
    Mu50:
    SAV2417
    MW2:
    MW2340
    RF122:
    SAB2297c
    ST398:
    SAPIG2468
    T0131:
    SAT0131_02609
    TCH60:
    HMPREF0772_10770
    TW20:
    SATW20_25470
    USA300_TCH1516:
    USA300HOU_2399
    VC40:
    SAVC_10960

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSHNENLKLAQRGAYLSLIVYIILSIVKYVTGFVFNSAAVRADALNNMTDIIVSLAVIIG
    N315            MSHNENLKLAQRGAYLSLIVYIILSIVKYVTGFVFNSAAVRADALNNMTDIIVSLAVIIG
    NCTC8325        MSHNENLKLAQRGAYLSLIVYIILSIVKYVTGFVFNSAAVRADALNNMTDIIVSLAVIIG
    Newman          MSHNENLKLAQRGAYLSLIVYIILSIVKYVTGFVFNSAAVRADALNNMTDIIVSLAVIIG
    USA300_FPR3757  MSHNENLKLAQRGAYLSLIVYIILSIVKYVTGFVFNSAAVRADALNNMTDIIVSLAVIIG
                    ************************************************************

    COL             LKISIKPADRNHPYGHLKSENISSLLVSFVIMFVGIQVVIQNAPRLFKEDDVVPNAITII
    N315            LKISIKPADRNHPYGHLKSENISSLLVSFVIMFVGIQVVIQNAPRLFKEDDVVPNAITII
    NCTC8325        LKISIKPADRNHPYGHLKSENISSLLVSFVIMFVGIQVVIQNAPRLFKEDDVVPNAITII
    Newman          LKISIKPADRNHPYGHLKSENISSLLVSFVIMFVGIQVVIQNAPRLFKEDDVVPNAITII
    USA300_FPR3757  LKISIKPADRNHPYGHLKSENISSLLVSFVIMFVGIQVVIQNAPRLFKEDDVVPNAITII
                    ************************************************************

    COL             VSLISGLVMLIVFAVNQRLAKRTKSSSLNSAAKDNLSDSLVSIGTAIGLIFTQIGFPIVD
    N315            VSLISGLVMLIVFAVNQRLAKRTKSSSLNSAAKDNLSDSLVSIGTAIGLIFTQIGFPIVD
    NCTC8325        VSLISGLVMLIVFAVNQRLAKRTKSSSLNSAAKDNLSDSLVSIGTAIGLIFTQIGFPIVD
    Newman          VSLISGLVMLIVFAVNQRLAKRTKSSSLNSAAKDNLSDSLVSIGTAIGLIFTQIGFPIVD
    USA300_FPR3757  VSLISGLVMLIVFAVNQRLAKRTKSSSLNSAAKDNLSDSLVSIGTAIGLIFTQIGFPIVD
                    ************************************************************

    COL             IILATLLGLLIVYTGFGIFKEAIFMLSDGFNETELEAYRNDILEVDEVQEVKSIKGRYHG
    N315            IILATLLGLLIVYTGFGIFKEAIFMLSDGFNETELEAYRNDILEVDEVQEVKSIKGRYHG
    NCTC8325        IILATLLGLLIVYTGFGIFKEAIFMLSDGFNETELEAYRNDILEVDEVQEVKSIKGRYHG
    Newman          IILATLLGLLIVYTGFGIFKEAIFMLSDGFNETELEAYRNDILEVDEVQEVKSIKGRYHG
    USA300_FPR3757  IILATLLGLLIVYTGFGIFKEAIFMLSDGFNETELEAYRNDILEVDEVQEVKSIKGRYHG
                    ************************************************************

    COL             SSVFIDVTIVVDANLSLVEAHQICDNVEHHLHKKGISSVYVHPEPDHL
    N315            SSVFIDVTIVVDANLSLVEAHQICDNVEHHLHKKGISSVYVHPEPDHL
    NCTC8325        SSVFIDVTIVVDANLSLVEAHQICDNVEHHLHKKGISSVYVHPEPDHL
    Newman          SSVFIDVTIVVDANLSLVEAHQICDNVEHHLHKKGISSVYVHPEPDHL
    USA300_FPR3757  SSVFIDVTIVVDANLSLVEAHQICDNVEHHLHKKGISSVYVHPEPDHL
                    ************************************************