From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005955000
  • symbol?: sbi
  • description?: immunoglobulin-binding protein sbi

      descriptions from strain specific annotations:

    • immunoglobulin-binding protein sbi
    • IgG-binding protein SBI
    • immunoglobulin G-binding protein Sbi
    • B domain protein
    • Ig-binding B domain-containing protein
  • strand?: +
  • coordinates?: 6017605..6018918
  • synteny block?: BlockID0046990
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2206 (sbi)
    NCTC8325:
    Newman:
    NWMN_2317 (sbi)
    USA300_FPR3757:
    04-02981:
    SA2981_2355 (sbi)
    08BA02176:
    C248_2465 (sbi)
    11819-97:
    MS7_2433 (sbi)
    71193:
    ST398NM01_2470
    ECT-R 2:
    ECTR2_2277
    ED133:
    SAOV_2466
    ED98:
    SAAV_2484
    HO 5096 0412:
    SAEMRSA15_23170 (sbi)
    JH1:
    SaurJH1_2492
    JH9:
    SaurJH9_2444
    JKD6008:
    SAA6008_02459 (sbi)
    JKD6159:
    SAA6159_02319 (sbi)
    LGA251:
    SARLGA251_22000 (sbi)
    M013:
    M013TW_2379
    MRSA252:
    SAR2508 (sbi)
    MSHR1132:
    SAMSHR1132_22470
    MSSA476:
    SAS2309
    Mu3:
    SAHV_2402 (sbi)
    Mu50:
    SAV2418 (sbi)
    MW2:
    MW2341 (sbi)
    RF122:
    SAB2298 (sbi)
    ST398:
    SAPIG2470
    T0131:
    SAT0131_02610
    TCH60:
    HMPREF0772_10769 (sbi)
    TW20:
    SATW20_25480 (sbi)
    USA300_TCH1516:
    USA300HOU_2401
    VC40:
    SAVC_10965

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNKYISKLLVGAATITLATMISNGEAKASENTQQTSTKHQTTQNNYVTDQQKAFYQVLH
    N315            MKNKYISKLLVGAATITLATMISNGEAKASENTQQTSTKHQTTQNNYVTDQQKAFYQVLH
    NCTC8325        MKNKYISKLLVGAATITLATMISNGEAKASENTQQTSTKHQTTQNNYVTDQQKAFYQVLH
    Newman          MKNKYISKLLVGAATITLATMISNGEAKASENTQQTSTKHQTTQNNYVTDQQKAFYQVLH
    USA300_FPR3757  MKNKYISKLLVGAATITLATMISNGEAKASENTQQTSTKHQTTQNNYVTDQQKAFYQVLH
                    ************************************************************

    COL             LKGITEEQRNQYIKTLREHPERAQEVFSESLKDSKNPDRRVAQQNAFYNVLKNDNLTEQE
    N315            LKGITEEQRNQYIKTLREHPERAQEVFSESLKDSKNPDRRVAQQNAFYNVLKNDNLTEQE
    NCTC8325        LKGITEEQRNQYIKTLREHPERAQEVFSESLKDSKNPDRRVAQQNAFYNVLKNDNLTEQE
    Newman          LKGITEEQRNQYIKTLREHPERAQEVFSESLKDSKNPDRRVAQQNAFYNVLKNDNLTEQE
    USA300_FPR3757  LKGITEEQRNQYIKTLREHPERAQEVFSESLKDSKNPDRRVAQQNAFYNVLKNDNLTEQE
                    ************************************************************

    COL             KNNYIAQIKENPDRSQQVWVESVQSSKAKERQNIENADKAIKDFQDNKAPHDKSAAYEAN
    N315            KNNYIAQIKENPDRSQQVWVESVQSSKAKERQNIENADKAIKDFQDNKAPHDKSAAYEAN
    NCTC8325        KNNYIAQIKENPDRSQQVWVESVQSSKAKERQNIENADKAIKDFQDNKAPHDKSAAYEAN
    Newman          KNNYIAQIKENPDRSQQVWVESVQSSKAKERQNIENADKAIKDFQDNKAPHDKSAAYEAN
    USA300_FPR3757  KNNYIAQIKENPDRSQQVWVESVQSSKAKERQNIENADKAIKDFQDNKAPHDKSAAYEAN
                    ************************************************************

    COL             SKLPKDLRDKNNRFVEKVSIEKAIVRHDERVKSANDAISKLNEKDSIENRRLAQREVNKA
    N315            SKLPKDLRDKNNRFVEKVSIEKAIVRHDERVKSANDAISKLNEKDSIENRRLAQREVNKA
    NCTC8325        SKLPKDLRDKNNRFVEKVSIEKAIVRHDERVKSANDAISKLNEKDSIENRRLAQREVNKA
    Newman          SKLPKDLRDKNNRFVEKVSIEKAIVRHDERVKSANDAISKLNEKDSIENRRLAQREVNKA
    USA300_FPR3757  SKLPKDLRDKNNRFVEKVSIEKAIVRHDERVKSANDAISKLNEKDSIENRRLAQREVNKA
                    ************************************************************

    COL             PMDVKEHLQKQLDALVAQKDAEKKVAPKVEAPQIQSPQIEKPKVESPKVEVPQIQSPKVE
    N315            PMDVKEHLQKQLDALVAQKDAEKKVAPKVEAPQIQSPQIEKPKAESPKVEVPQIQSPKVE
    NCTC8325        PMDVKEHLQKQLDALVAQKDAEKKVAPKVEAPQIQSPQIEKPKVESPKVEVPQIQSPKVE
    Newman          PMDVKEHLQKQLDALVAQKDAEKKVAPKVEAPQIQSPQIEKPKVESPKVEVPQIQSPKVE
    USA300_FPR3757  PMDVKEHLQKQLDALVAQKDAEKKVAPKVEAPQIQSPQIEKPKVESPKVEVPQIQSPKVE
                    *******************************************.****************

    COL             VPQSKLLGYYQSLKDSFNYGYKYLTDTYKSYKEKYDTAKYYYNTYYKYKGAIDQTVLTVL
    N315            VPQSKLLGYYQSLKDSFNYGYKYLTDTYKSYKEKYDTAKYYYNTYYKYKGAIDQTVLTVL
    NCTC8325        VPQSKLLGYYQSLKDSFNYGYKYLTDTYKSYKEKYDTAKYYYNTYYKYKGAIDQTVLTVL
    Newman          VPQSKLLGYYQSLKDSFNYGYKYLTDTYKSYKEKYDTAKYYYNTYYKYKGAIDQTVLTVL
    USA300_FPR3757  VPQSKLLGYYQSLKDSFNYGYKYLTDTYKSYKEKYDTAKYYYNTYYKYKGAIDQTVLTVL
                    ************************************************************

    COL             GSGSKSYIQPLKVDDKNGYLAKSYAQVRNYVTESINTGKVLYTFYQNPTLVKTAIKAQET
    N315            GSGSKSYIQPLKVDDKNGYLAKSYAQVRNYVTESINTGKVLYTFYQNPTLVKTAIKAQET
    NCTC8325        GSGSKSYIQPLKVDDKNGYLAKSYAQVRNYVTESINTGKVLYTFYQNPTLVKTAIKAQET
    Newman          GSGSKSYIQPLKVDDKNGYLAKSYAQVRNYVTESINTGKVLYTFYQNPTLVKTAIKAQET
    USA300_FPR3757  GSGSKSYIQPLKVDDKNGYLAKSYAQVRNYVTESINTGKVLYTFYQNPTLVKTAIKAQET
                    ************************************************************

    COL             ASSIKNTLSNLLSFWK
    N315            ASSIKNTLSNLLSFWK
    NCTC8325        ASSIKNTLSNLLSFWK
    Newman          ASSIKNTLSNLLSFWK
    USA300_FPR3757  ASSIKNTLSNLLSFWK
                    ****************