From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005960000
  • symbol?: hlgC
  • description?: gamma-hemolysin component C

      descriptions from strain specific annotations:

    • gamma-hemolysin component C
    • beta-channel forming cytolysin
    • gamma hemolysin, component C
    • leukocidin-S subunit
    • gamma-hemolysin component C precursor
    • gamma-hemolysin component C precursor, HlgC
  • strand?: +
  • coordinates?: 6022158..6023108
  • synteny block?: BlockID0047040
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2421 (hlgC)
    N315:
    SA2208 (hlgC)
    NCTC8325:
    Newman:
    NWMN_2319 (hlgC)
    USA300_FPR3757:
    04-02981:
    SA2981_2357 (hlgC)
    08BA02176:
    C248_2468 (hlgC)
    11819-97:
    MS7_2435 (hlgC)
    71193:
    ST398NM01_2473
    ECT-R 2:
    ECTR2_2279
    ED133:
    SAOV_2469
    ED98:
    SAAV_2486 (hlgC)
    HO 5096 0412:
    SAEMRSA15_23190 (hlgC)
    JH1:
    SaurJH1_2494
    JH9:
    SaurJH9_2446
    JKD6008:
    SAA6008_02461 (hlgC)
    JKD6159:
    SAA6159_02321 (hlgC)
    LGA251:
    SARLGA251_22020 (hlgC)
    M013:
    M013TW_2382
    MRSA252:
    SAR2510 (hlgC)
    MSHR1132:
    SAMSHR1132_22490
    MSSA476:
    SAS2311
    Mu3:
    SAHV_2404 (hlgC)
    Mu50:
    SAV2420 (hlgC)
    MW2:
    MW2343 (hlgC)
    RF122:
    SAB2301 (hlgC)
    ST398:
    SAPIG2473
    T0131:
    SAT0131_02615
    TCH60:
    HMPREF0772_10767 (hlgC)
    TW20:
    SATW20_25500 (hlgC)
    USA300_TCH1516:
    USA300HOU_2404 (hlgC)
    VC40:
    SAVC_10975

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLKNKILTTTLSVSLLAPLANPLLENAKAANDTEDIGKGSDIEIIKRTEDKTSNKWGVTQ
    N315            MLKNKILATTLSVSLLAPLANPLLENAKAANDTEDIGKGSDIEIIKRTEDKTSNKWGVTQ
    NCTC8325        MLKNKILTTTLSVSLLAPLANPLLENAKAANDTEDIGKGSDIEIIKRTEDKTSNKWGVTQ
    Newman          MLKNKILTTTLSVSLLAPLANPLLENAKAANDTEDIGKGSDIEIIKRTEDKTSNKWGVTQ
    USA300_FPR3757  MLKNKILTTTLSVSLLAPLANPLLENAKAANDTEDIGKGSDIEIIKRTEDKTSNKWGVTQ
                    *******:****************************************************

    COL             NIQFDFVKDKKYNKDALILKMQGFISSRTTYYNYKKTNHVKAMRWPFQYNIGLKTNDKYV
    N315            NIQFDFVKDKKYNKDALILKMQGFISSRTTYYNYKKTNHVKAMRWPFQYNIGLKTNDKYV
    NCTC8325        NIQFDFVKDKKYNKDALILKMQGFISSRTTYYNYKKTNHVKAMRWPFQYNIGLKTNDKYV
    Newman          NIQFDFVKDKKYNKDALILKMQGFISSRTTYYNYKKTNHVKAMRWPFQYNIGLKTNDKYV
    USA300_FPR3757  NIQFDFVKDKKYNKDALILKMQGFISSRTTYYNYKKTNHVKAMRWPFQYNIGLKTNDKYV
                    ************************************************************

    COL             SLINYLPKNKIESTNVSQILGYNIGGNFQSAPSLGGNGSFNYSKSISYTQQNYVSEVEQQ
    N315            SLINYLPKNKIESTNVSQTLGYNIGGNFQSAPSLGGNGSFNYSKSISYTQQNYVSEVEQQ
    NCTC8325        SLINYLPKNKIESTNVSQTLGYNIGGNFQSAPSLGGNGSFNYSKSISYTQQNYVSEVEQQ
    Newman          SLINYLPKNKIESTNVSQTLGYNIGGNFQSAPSLGGNGSFNYSKSISYTQQNYVSEVEQQ
    USA300_FPR3757  SLINYLPKNKIESTNVSQTLGYNIGGNFQSAPSLGGNGSFNYSKSISYTQQNYVSEVEQQ
                    ****************** *****************************************

    COL             NSKSVLWGVKANSFATESGQKSAFDSDLFVGYKPHSKDPRDYFVPDSELPPLVQSGFNPS
    N315            NSKSVLWGVKANSFATESGQKSAFDSDLFVGYKPHSKDPRDYFVPDSELPPLVQSGFNPS
    NCTC8325        NSKSVLWGVKANSFATESGQKSAFDSDLFVGYKPHSKDPRDYFVPDSELPPLVQSGFNPS
    Newman          NSKSVLWGVKANSFATESGQKSAFDSDLFVGYKPHSKDPRDYFVPDSELPPLVQSGFNPS
    USA300_FPR3757  NSKSVLWGVKANSFATESGQKSAFDSDLFVGYKPHSKDPRDYFVPDSELPPLVQSGFNPS
                    ************************************************************

    COL             FIATVSHEKGSSDTSEFEITYGRNMDVTHAIKRSTHYGNSYLDGHRVHNAFVNRNYTVKY
    N315            FIATVSHEKGSSDTSEFEITYGRNMDVTHAIKRSTHYGNSYLDGHRVHNAFVNRNYTVKY
    NCTC8325        FIATVSHEKGSSDTSEFEITYGRNMDVTHAIKRSTHYGNSYLDGHRVHNAFVNRNYTVKY
    Newman          FIATVSHEKGSSDTSEFEITYGRNMDVTHAIKRSTHYGNSYLDGHRVHNAFVNRNYTVKY
    USA300_FPR3757  FIATVSHEKGSSDTSEFEITYGRNMDVTHAIKRSTHYGNSYLDGHRVHNAFVNRNYTVKY
                    ************************************************************

    COL             EVNWKTHEIKVKGQN
    N315            EVNWKTHEIKVKGQN
    NCTC8325        EVNWKTHEIKVKGQN
    Newman          EVNWKTHEIKVKGQN
    USA300_FPR3757  EVNWKTHEIKVKGQN
                    ***************