From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005962000
  • symbol?: bioX
  • description?: Biotin biosynthesis-related protein

      descriptions from strain specific annotations:

    • Biotin biosynthesis-related protein
    • Biox
    • membrane protein
    • queT transporter family protein
  • strand?: -
  • coordinates?: 6024146..6024613
  • synteny block?: BlockID0047060
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_2321 (bioX)
    USA300_FPR3757:
    04-02981:
    SA2981_2359
    08BA02176:
    C248_2470
    11819-97:
    MS7_2437
    71193:
    ST398NM01_2475
    ECT-R 2:
    ECTR2_2281
    ED133:
    SAOV_2471c
    ED98:
    SAAV_2488
    HO 5096 0412:
    SAEMRSA15_23210
    JH1:
    SaurJH1_2496
    JH9:
    SaurJH9_2448
    JKD6008:
    SAA6008_02463
    JKD6159:
    SAA6159_02323
    LGA251:
    SARLGA251_22040
    M013:
    M013TW_2384
    MRSA252:
    SAR2512
    MSHR1132:
    SAMSHR1132_22510
    MSSA476:
    SAS2313
    Mu3:
    SAHV_2406
    Mu50:
    SAV2422
    MW2:
    MW2345
    RF122:
    SAB2303c
    ST398:
    SAPIG2475
    T0131:
    SAT0131_02617
    TCH60:
    HMPREF0772_10765
    TW20:
    SATW20_25520
    USA300_TCH1516:
    USA300HOU_2406
    VC40:
    SAVC_10985

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTSKDITQISVIAAILTILAVLKIPSIIPGLDFQLSAPAALLILAFFGIKKYFLGGLLSS
    N315            MTSKDITQISVIAAILTILAVLKIPSIIPGLDFQLSAPAALLILAFFGIKKYFLGGLLSS
    NCTC8325        MTSKDITQISVIAAILTILAVLKIPSIIPGLDFQLSAPAALLILAFFGIKKYFLGGLLSS
    Newman          MTSKDITQISVIAAILTILAVLKIPSIIPGLDFQLSAPAALLILAFFGIKKYFLGGLLSS
    USA300_FPR3757  MTSKDITQISVIAAILTILAVLKIPSIIPGLDFQLSAPAALLILAFFGIKKYFLGGLLSS
                    ************************************************************

    COL             LLLLVFGVFNPINVIISIIFRVIAIAVVYLLKINVLSLVLASVLGSLVYRLLLSIILNLP
    N315            VLLLIFGVFNPINVIISIIFRVIAIAVVYLLKINVLSLVLSSVLGSLVSRLLLSIILNLP
    NCTC8325        LLLLVFGVFNPINVIISIIFRVIAIAVVYLLKINVLSLVLASVLGSLVSRLLLSIILNLP
    Newman          LLLLVFGVFNPINVIISIIFRVIAIAVVYLLKINVLSLVLASVLGSLVSRLLLSIILNLP
    USA300_FPR3757  LLLLVFGVFNPINVIISIIFRVIAIAVVYLLKINVLSLVLASVLGSLVSRLLLSIILNLP
                    :***:***********************************:******* ***********

    COL             VWVVLLNAIPGVIFTLIVAIPLYLTLRKRMAVLLR
    N315            VWVVLLNAIPGVIFTLIVAIPLYLTLRKRMAVLLR
    NCTC8325        VWVVLLNAIPGVIFTLIVAIPLYLTLRKRMAVLLR
    Newman          VWVVLLNAIPGVIFTLIVAIPLYLTLRKRMAVLLR
    USA300_FPR3757  VWVVLLNAIPGVIFTLIVAIPLYLTLRKRMAVLLR
                    ***********************************