From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005971000
  • symbol?:
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • ABC transporter ATP-binding protein/permease
    • ABC transporter ATP-binding/permease
    • ABC superfamily ATP binding cassette transporter, ABC/membrane protein
    • ABC transporter, ATP-binding/permease protein
    • ABC transporter family protein
    • pseudogene
  • strand?: -
  • coordinates?: 6031251..6032984
  • synteny block?: BlockID0047150
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2365
    08BA02176:
    C248_2477
    11819-97:
    MS7_2443
    71193:
    ST398NM01_2481
    ECT-R 2:
    ECTR2_2287
    ED133:
    SAOV_2477c
    ED98:
    SAAV_2494
    HO 5096 0412:
    SAEMRSA15_23290
    JH1:
    SaurJH1_2502
    JH9:
    SaurJH9_2454
    JKD6008:
    SAA6008_02470
    JKD6159:
    LGA251:
    SARLGA251_22100
    M013:
    M013TW_2391
    MRSA252:
    SAR2518
    MSHR1132:
    SAMSHR1132_22570
    MSSA476:
    SAS2319
    Mu3:
    SAHV_2412
    Mu50:
    SAV2428
    MW2:
    MW2351
    RF122:
    SAB2309c
    ST398:
    SAPIG2481
    T0131:
    SAT0131_02624
    TCH60:
    HMPREF0772_10759
    TW20:
    SATW20_25580
    USA300_TCH1516:
    USA300HOU_2412
    VC40:
    SAVC_11015

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFQITFKILNWIRPYKARMILGFSMSFLNAIFIALPIFLAAKIFNNVLSHKPIYMKDILN
    N315            MFQITFKILNWIRPYKARMILGFSMSFLNAIFIALPIFLAAKIFNNVLSHKPIYMKDILN
    NCTC8325        MFQITFKILNWIRPYKARMILGFSMSFLNAIFIALPIFLAAKIFNNVLSHKPIYMKDILN
    Newman          MFQITFKILNWIRPYKARMILGFSMSFLNAIFIALPIFLAAKIFNNVLSHKPIYMKDILN
    USA300_FPR3757  MFQITFKILNWIRPYKARMILGFSMSFLNAIFIALPIFLAAKIFNNVLSHKPIYMKDILN
                    ************************************************************

    COL             VVIIMVLLVIGRFITAYFKSKSHESIAYEMSAKERLDIGDKLKNVRLGYFNSHHSNELTT
    N315            VVIIMVLLVIGRFITAYFKSKSHESIAYEMSAKERLDIGDKLKNVRLGYFNSHHSNELTT
    NCTC8325        VVIIMVLLVIGRFITAYFKSKSHESIAYEMSAKERLDIGDKLKNVRLGYFNSHHSNELTT
    Newman          VVIIMVLLVIGRFITAYFKSKSHESIAYEMSAKERLDIGDKLKNVRLGYFNSHHSNELTT
    USA300_FPR3757  VVIIMVLLVIGRFITAYFKSKSHESIAYEMSAKERLDIGDKLKNVRLGYFNSHHSNELTT
                    ************************************************************

    COL             IVTTDLTFLENFAMKMVDVVVNGYILITVLILSLLVVSWQVSLLACIGVLLSFFAIQLLE
    N315            IVTTDLTFLENFAMKMVDIVVNGYILITVLILSLLVVSWQVSLLACIGVLLSFFAIQLLE
    NCTC8325        IVTTDLTFLENFAMKMVDVVVNGYILITVLILSLLVVSWQVSLLACIGVLLSFFAIQLLE
    Newman          IVTTDLTFLENFAMKMVDVVVNGYILITVLILSLLVVSWQVSLLACIGVLLSFFAIQLLE
    USA300_FPR3757  IVTTDLTFLENFAMKMVDVVVNGYILITVLILSLLVVSWQVSLLACIGVLLSFFAIQLLE
                    ******************:*****************************************

    COL             RKSRQNAPAYHNVQNQLVEKVLEVIRGIQVIKSFAKENTSLKSFNQAVNESKRINTKIEM
    N315            RKSRQNAPAYHNVQNQLVEKVLEVIRGIQVIKSFAKENTSLKSFNQAVNESKRINTKIEM
    NCTC8325        RKSRQNAPAYHNVQNQLVEKVLEVIRGIQVIKSFAKENTSLKSFNQAVNESKRINTKIEM
    Newman          RKSRQNAPAYHNVQNQLVEKVLEVIRGIQVIKSFAKENTSLKSFNQAVNESKRINTKIEM
    USA300_FPR3757  RKSRQNAPAYHNVQNQLVEKVLEVIRGIQVIKSFAKENTSLKSFNQAVNESKRINTKIEM
                    ************************************************************

    COL             QYIPFNLLHLLSLKVVSIMIVLVACLLYMNHSIDLPTLIMISIFSFVIFDSVENINSAAH
    N315            QYIPFNLLHLLSLKVVSIMIVLVACLLYMNHSIDLPTLIMISIFSFVIFDSVENINSAAH
    NCTC8325        QYIPFNLLHLLSLKVVSIMIVLVACLLYMNHSIDLPTLIMISIFSFVIFDSVENINSAAH
    Newman          QYIPFNLLHLLSLKVVSIMIVLVACLLYMNHSIDLPTLIMISIFSFVIFDSVENINSAAH
    USA300_FPR3757  QYIPFNLLHLLSLKVVSIMIVLVACLLYMNHSIDLPTLIMISIFSFVIFDSVENINSAAH
                    ************************************************************

    COL             VLEMIDMTIDDIEKIKNAPELDENGKNLTIKNENIAFQNVNFSYDDKQVIKNVNFEIPTQ
    N315            VLEMIDMTIDDIEKIKNAPELDENGKNLTIKNENIAFQNVNFSYDDKQVIKNVNFEIPTQ
    NCTC8325        VLEMIDMTIDDIEKIKNAPELDENGKNLTIKNENIAFQNVNFSYDDKQVIKNVNFEIPTQ
    Newman          VLEMIDMTIDDIEKIKNAPELDENGKNLTIKNENIAFQNVNFSYDDKQVIKNVNFEIPTQ
    USA300_FPR3757  VLEMIDMTIDDIEKIKNAPELDENGKNLTIKNENIAFQNVNFSYDDKQVIKNVNFEIPTQ
                    ************************************************************

    COL             TSTAIIGPSGSGKSTLCHLLLRFYDIDDGNIRIDGVDIKDMTLSTLMSKISAVFQKVYLF
    N315            TSTAIIGPSGSGKSTLCHLLLRFYDIDDGNIRIDGVDIKDMTLSTLMSKISAVFQKVYLF
    NCTC8325        TSTAIIGPSGSGKSTLCHLLLRFYDIDDGNIRIDGVDIKDMTLSTLMSKISAVFQKVYLF
    Newman          TSTAIIGPSGSGKSTLCHLLLRFYDIDDGNIRIDGVDIKDMTLSTLMSKISAVFQKVYLF
    USA300_FPR3757  TSTAIIGPSGSGKSTLCHLLLRFYDIDDGNIRIDGVDIKDMTLSTLMSKISAVFQKVYLF
                    ************************************************************

    COL             NDTIENNILFGNPGATKEEIIRATKQACCHDFIMSLPEGYQTMLNEKGSNLSGGEKQRIS
    N315            NDTIENNILFGNPGATKEEIIRAAKQACCHDFIMSLPEGYQTMLNEKGSNLSGGEKQRIS
    NCTC8325        NDTIENNILFGNPGATKEEIIRAAKQACCHDFIMSLPEGYQTMLNEKGSNLSGGEKQRIS
    Newman          NDTIENNILFGNPGATKEEIIRAAKQACCHDFIMSLPEGYQTMLNEKGSNLSGGEKQRIS
    USA300_FPR3757  NDTIENNILFGNPGATKEEIIRAAKQACCHDFIMSLPEGYQTMLNEKGSNLSGGEKQRIS
                    ***********************:************************************

    COL             IARAILKDAPIIILDEATASIDPENEQLIQTAINELSKGKTVITIAHKLETIKNADQIIV
    N315            IARAILKDAPIIILDEATASIDPENEQLIQTAINELSKGKTVITIAHKLETIKNADQIIV
    NCTC8325        IARAILKDAPIIILDEATASIDPENEQLIQTAINELSKGKTVITIAHKLETIKNADQIIV
    Newman          IARAILKDAPIIILDEATASIDPENEQLIQTAINELSKGKTVITIAHKLETIKNADQIIV
    USA300_FPR3757  IARAILKDAPIIILDEATASIDPENEQLIQTAINELSKGKTVITIAHKLETIKNADQIIV
                    ************************************************************

    COL             LNEGEIIQKGSHDELIRKPGMYQDFIRIKSKSAGWKL
    N315            LNEGEIIQKGSHDELIRKPGMYQDFIRIKSKSAGWKL
    NCTC8325        LNEGEIIQKGSHDELIRKPGMYQDFIRIKSKSAGWKL
    Newman          LNEGEIIQKGSHDELIRKPGMYQDFIRIKSKSAGWKL
    USA300_FPR3757  LNEGEIIQKGSHDELIRKPGMYQDFIRIKSKSAGWKL
                    *************************************