From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan005972000
  • symbol?:
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • ABC transporter ATP-binding protein/permease
    • ABC transporter ATP-binding/permease
    • ABC superfamily ATP binding cassette transporter, ABC/membrane protein
    • ABC transporter ATPase/permease
    • truncated ATP-binding ABC transporter
  • strand?: -
  • coordinates?: 6033009..6034706
  • synteny block?: BlockID0047160
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2366
    08BA02176:
    C248_2478
    11819-97:
    MS7_2444
    71193:
    ST398NM01_2482
    ECT-R 2:
    ECTR2_2288
    ED133:
    SAOV_2478c
    ED98:
    SAAV_2495
    HO 5096 0412:
    SAEMRSA15_23300
    JH1:
    SaurJH1_2503
    JH9:
    SaurJH9_2455
    JKD6008:
    SAA6008_02471
    JKD6159:
    LGA251:
    SARLGA251_22110
    M013:
    M013TW_2392
    MRSA252:
    SAR2519
    MSHR1132:
    SAMSHR1132_22580
    MSSA476:
    SAS2320
    Mu3:
    SAHV_2413
    Mu50:
    SAV2429
    MW2:
    MW2352
    RF122:
    SAB2310c
    ST398:
    SAPIG2482
    T0131:
    SAT0131_02625
    TCH60:
    HMPREF0772_10758
    TW20:
    SATW20_25590
    USA300_TCH1516:
    USA300HOU_2413
    VC40:
    SAVC_11020

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNNQTNWIKILSGFASDSKWKIMLSILLSIISVFSGLVPYWAVFKIILMMINNTYTINSI
    N315            MNNQTNWIKILSGFASDSKWKIMLSILLSIISVFSGLVPYWAVFKIILMMINNAYTINSI
    NCTC8325        MNNQTNWIKILSGFASDSKWKIMLSILLSIISVFSGLVPYWAVFKIILMMINNTYTINSI
    Newman          MNNQTNWIKILSGFASDSKWKIMLSILLSIISVFSGLVPYWAVFKIILMMINNTYTINSI
    USA300_FPR3757  MNNQTNWIKILSGFASDSKWKIMLSILLSIISVFSGLVPYWAVFKIILMMINNTYTINSI
                    *****************************************************:******

    COL             MVYIFIALIAYISQVCCFGASTMLSHITAYEILSEIRKKLAQKLMRLPLGVVESKKIGEL
    N315            MVYIFIALITYISQVCCFGASTMLSHITAYEILSEIRKKLAQKLMRLPLGVVESKKIGEL
    NCTC8325        MVYIFIALIAYISQVCCFGASTMLSHITAYEILSEIRKKLAQKLMRLPLGVVESKKIGEL
    Newman          MVYIFIALIAYISQVCCFGASTMLSHITAYEILSEIRKKLAQKLMRLPLGVVESKKIGEL
    USA300_FPR3757  MVYIFIALIAYISQVCCFGASTMLSHITAYEILSEIRKKLAQKLMRLPLGVVESKKIGEL
                    *********:**************************************************

    COL             KNIFVDKVETIELPLAHMIPEVIGNLLLSAAIFLYIMLIDWRMASALLVTIPISIFAFKK
    N315            KNIFVDKVETIELPLAHMIPEVIGNLLLSAAIFLYIMLIDWRMASALLVTIPISIFAFKK
    NCTC8325        KNIFVDKVETIELPLAHMIPEVIGNLLLSAAIFLYIMLIDWRMASALLVTIPISIFAFKK
    Newman          KNIFVDKVETIELPLAHMIPEVIGNLLLSAAIFLYIMLIDWRMASALLVTIPISIFAFKK
    USA300_FPR3757  KNIFVDKVETIELPLAHMIPEVIGNLLLSAAIFLYIMLIDWRMASALLVTIPISIFAFKK
                    ************************************************************

    COL             VMSGFNETYAEQMKSNNYMNSAIVEFIEGIEVIKTFNQSQSSYKKYKDAVDNYKIHTLNW
    N315            VMSGFNETYAEQMKSNNYMNSAIVEFIEGIEVIKTFNQSQSSYKKYKDAVDNYKIHTLNW
    NCTC8325        VMSGFNETYAEQMKSNNYMNSAIVEFIEGIEVIKTFNQSQSSYKKYKDAVDNYKIHTLNW
    Newman          VMSGFNETYAEQMKSNNYMNSAIVEFIEGIEVIKTFNQSQSSYKKYKDAVDNYKIHTLNW
    USA300_FPR3757  VMSGFNETYAEQMKSNNYMNSAIVEFIEGIEVIKTFNQSQSSYKKYKDAVDNYKIHTLNW
                    ************************************************************

    COL             FKNTWGYMNLGASVLPSTFLGILPVGMYLISINQLNYAEFFLCIVLSLGVVAPIKNFTNY
    N315            FKNTWGYMNLGASVLPSTFLGILPVGMYLISINQLNYAEFFLCIVLSLGVVAPIKNFTNY
    NCTC8325        FKNTWGYMNLGASVLPSTFLGILPVGMYLISINQLNYAEFFLCIVLSLGVVAPIKNFTNY
    Newman          FKNTWGYMNLGASVLPSTFLGILPVGMYLISINQLNYAEFFLCIVLSLGVVAPIKNFTNY
    USA300_FPR3757  FKNTWGYMNLGASVLPSTFLGILPVGMYLISINQLNYAEFFLCIVLSLGVVAPIKNFTNY
                    ************************************************************

    COL             VNHLKSIQYALTEVNQILSLEELVLSTKFKKPQHYEIAFNNVGFSYNKDKDDLVFKHLSF
    N315            VNHLKSIQYALTEVNQILSLEELVLSTKFKKPQHYEIAFNNVGFSYNKDKDDLVFKHLSF
    NCTC8325        VNHLKSIQYALTEVNQILSLEELVLSTKFKKPQHYEIAFNNVGFSYNKDKDDLVFKHLSF
    Newman          VNHLKSIQYALTEVNQILSLEELVLSTKFKKPQHYEIAFNNVGFSYNKDKDDLVFKHLSF
    USA300_FPR3757  VNHLKSIQYALTEVNQILSLEELVLSTKFKKPQHYEIAFNNVGFSYNKDKDDLVFKHLSF
                    ************************************************************

    COL             TVPENNFTAIVGASGSGKSTIAKLISRYWDVTSGEITIGGINIKDIESKQLNDLVGFVGQ
    N315            TVPENNFTAIVGASGSGKSTIAKLISRYWDVTSGEITIGGINIKDIESKQLNDLVGFVGQ
    NCTC8325        TVPENNFTAIVGASGSGKSTIAKLISRYWDVTSGEITIGGINIKDIESKQLNDLVGFVGQ
    Newman          TVPENNFTAIVGASGSGKSTIAKLISRYWDVTSGEITIGGINIKDIESKQLNDLVGFVGQ
    USA300_FPR3757  TVPENNFTAIVGASGSGKSTIAKLISRYWDVTSGEITIGGINIKDIESKQLNDLVGFVGQ
                    ************************************************************

    COL             DNFLLNLTFKENIKLGNPEATDEAVEKAAKLAQCHEFIEKLPDGYDTNVGTVGDKLSGGE
    N315            DNFLLNLTFKENIKLGNPEATDEAVEKAAKLAQCHEFIEKLPDGYDTNVGTVGDKLSGGE
    NCTC8325        DNFLLNLTFKENIKLGNPEATDEAVEKAAKLAQCHEFIEKLPDGYDTNVGTVGDKLSGGE
    Newman          DNFLLNLTFKENIKLGNPEATDEAVEKAAKLAQCHEFIEKLPDGYDTNVGTVGDKLSGGE
    USA300_FPR3757  DNFLLNLTFKENIKLGNPEATDEAVEKAAKLAQCHEFIEKLPDGYDTNVGTVGDKLSGGE
                    ************************************************************

    COL             KQRVTIARMILKDAPIIVLDEATVYVDPDNEQKIQEALNVLTQDKTLIVIAHRLSTIQHA
    N315            KQRVTIARMILKDAPIIVLDEATAYVDPDNEQKIQEALNVLTQDKTLIVIAHRLSTIQHA
    NCTC8325        KQRVTIARMILKDAPIIVLDEATVYVDPDNEQKIQEALNVLTQDKTLIVIAHRLSTIQHA
    Newman          KQRVTIARMILKDAPIIVLDEATVYVDPDNEQKIQEALNVLTQDKTLIVIAHRLSTIQHA
    USA300_FPR3757  KQRVTIARMILKDAPIIVLDEATVYVDPDNEQKIQEALNVLTQDKTLIVIAHRLSTIQHA
                    ***********************.************************************

    COL             DQIIVLGKQQILEKGSHHLLLKLNGNYKKMWDTHMHTKDWGINTGHN
    N315            DQIIVLGKQQILEKGSHHLLLKLNGNYKKMWDTHMHTKDWGINTGHN
    NCTC8325        DQIIVLGKQQILEKGSHHLLLKLNGNYKKMWDTHMHTKDWGINTGHN
    Newman          DQIIVLGKQQILEKGSHHLLLKLNGNYKKMWDTHMHTKDWGINTGHN
    USA300_FPR3757  DQIIVLGKQQILEKGSHHLLLKLNGNYKKMWDTHMHTKDWGINTGHN
                    ***********************************************