Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005990000
  • symbol?: kimA
  • description?: Amino acid permease

      descriptions from strain specific annotations:

    • Amino acid permease
    • amino acid transporter-like protein
    • membrane permease
    • APC family amino acid-polyamine-organocation transporter
    • truncated amino acid-polyamine-organocation transporter PotE
  • strand?: -
  • coordinates?: 6051035..6052747
  • synteny block?: BlockID0047340
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2377
    08BA02176:
    C248_2489
    11819-97:
    MS7_2454
    71193:
    ST398NM01_2492
    ECT-R 2:
    ECTR2_2298
    ED133:
    SAOV_2490c
    ED98:
    SAAV_2506
    HO 5096 0412:
    SAEMRSA15_23400
    JH1:
    SaurJH1_2515
    JH9:
    SaurJH9_2466
    JKD6008:
    SAA6008_02481
    JKD6159:
    SAA6159_02338
    LGA251:
    SARLGA251_22210
    M013:
    M013TW_2403
    MRSA252:
    SAR2530
    MSHR1132:
    SAMSHR1132_22680
    MSSA476:
    SAS2332
    Mu3:
    SAHV_2424
    Mu50:
    SAV2440
    MW2:
    MW2364
    RF122:
    SAB2322c
    ST398:
    SAPIG2492
    T0131:
    SAT0131_02637 (fabD)
    TCH60:
    HMPREF0772_10748
    TW20:
    SATW20_25690
    USA300_TCH1516:
    USA300HOU_2427
    VC40:
    SAVC_11075 (potE)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFNQFKRLIIGQPKKNRELKDEKISKFKGLAILSSDALSSVAYGPEQILITLSVVGAVAT
    N315            MFNQFKRLIIGQPKKNRELKDEKISKFKGLAILSSDALSSVAYGPEQILITLSVVGAVAT
    NCTC8325        MFNQFKRLIIGQPKKNRELKDEKISKFKGLAILSSDALSSVAYGPEQILITLSVVGAVAT
    Newman          MFNQFKRLIIGQPKKNRELKDEKISKFKGLAILSSDALSSVAYGPEQILITLSVVGAVAT
    USA300_FPR3757  MFNQFKRLIIGQPKKNRELKDEKISKFKGLAILSSDALSSVAYGPEQILITLSVVGAVAT
                    ************************************************************

    COL             WYTLPIAGAVLILLAALIMSYRQIIYAYPKGGGAYMVSKTNLGEKWGLLAGGSLLVDYIL
    N315            WYTLPIAGAVLILLAALIMSYRQIIYAYPKGGGAYMVSKTNLGEKWGLLAGGSLLVDYIL
    NCTC8325        WYTLPIAGAVLILLAALIMSYRQIIYAYPKGGGAYMVSKTNLGEKWGLLAGGSLLVDYIL
    Newman          WYTLPIAGAVLILLAALIMSYRQIIYAYPKGGGAYMVSKTNLGEKWGLLAGGSLLVDYIL
    USA300_FPR3757  WYTLPIAGAVLILLAALIMSYRQIIYAYPKGGGAYMVSKTNLGEKWGLLAGGSLLVDYIL
                    ************************************************************

    COL             TVAVSISSGADAFVAAFPSLYGHKVLIACLLVLFILILNLRGLTESATVLSYPVYLFIIG
    N315            TVAVSISSGADAFVAAFPSLYGHKVLIACLLVLFILILNLRGLTESATVLSYPVYLFIIG
    NCTC8325        TVAVSISSGADAFVAAFPSLYGHKVLIACLLVLFILILNLRGLTESATVLSYPVYLFIIG
    Newman          TVAVSISSGADAFVAAFPSLYGHKVLIACLLVLFILILNLRGLTESATVLSYPVYLFIIG
    USA300_FPR3757  TVAVSISSGADAFVAAFPSLYGHKVLIACLLVLFILILNLRGLTESATVLSYPVYLFIIG
                    ************************************************************

    COL             LVILIFIGTFRVATGDIQPHMHASVGTAVPGVTLFLLLKAFSSGASSLTGVEAISNAVTN
    N315            LVILIFIGTFRVATGDIQPHMHASVGTAVPGVTLFLLLKAFSSGASSLTGVEAISNAVTN
    NCTC8325        LVILIFIGTFRVATGDIQPHMHASVGTAVPGVTLFLLLKAFSSGASSLTGVEAISNAVTN
    Newman          LVILIFIGTFRVATGDIQPHMHASVGTAVPGVTLFLLLKAFSSGASSLTGVEAISNAVTN
    USA300_FPR3757  LVILIFIGTFRVATGDIQPHMHASVGTAVPGVTLFLLLKAFSSGASSLTGVEAISNAVTN
                    ************************************************************

    COL             FREPSAKNAVKTLIAMGSILAFLLVGIVGLAYVYGILPQTETTVLSQLAMQIFGDNAAFY
    N315            FREPSANNAVKTLIAMGSILAFLLVGIVGLAYVYGIMPQTETTVLSQLAMQIFGDNAAFY
    NCTC8325        FREPSAKNAVKTLIAMGSILAFLLVGIVGLAYVYGILPQTETTVLSQLAMQIFGDNAAFY
    Newman          FREPSAKNAVKTLIAMGSILAFLLVGIVGLAYVYGILPQTETTVLSQLAMQIFGDNAAFY
    USA300_FPR3757  FREPSAKNAVKTLIAMGSILAFLLVGIVGLAYVYGILPQTETTVLSQLAMQIFGDNAAFY
                    ******:*****************************:***********************

    COL             FVQATTVMILVLAANTGFTAFPMLAASMSKDKYMPRMFTVRGDRLGYSNSIIILGVLAII
    N315            FVQATTVMILVLAANTGFTAFPMLAASMSKDKYMPRMFTVRGDRLGYSNSIIILGVLAII
    NCTC8325        FVQATTVMILVLAANTGFTAFPMLAASMSKDKYMPRMFTVRGDRLGYSNSIIILGVLAII
    Newman          FVQATTVMILVLAANTGFTAFPMLAASMSKDKYMPRMFTVRGDRLGYSNSIIILGVLAII
    USA300_FPR3757  FVQATTVMILVLAANTGFTAFPMLAASMSKDKYMPRMFTVRGDRLGYSNSIIILGVLAII
                    ************************************************************

    COL             LIIVFDGMTEDLIPLYAVGVFIPFTLAQFGMVIKWIHERPKNWLSKLSVNLLGGIVTFIV
    N315            LIIVFDGMTEDLIPLYAVGVFIPFTLAQFGMVIKWIHERPKNWLSKLSVNLLGGIVTFIV
    NCTC8325        LIIVFDGMTEDLIPLYAVGVFIPFTLAQFGMVIKWIHERPKNWLSKLSVNLLGGIVTFIV
    Newman          LIIVFDGMTEDLIPLYAVGVFIPFTLAQFGMVIKWIHERPKNWLSKLSVNLLGGIVTFIV
    USA300_FPR3757  LIIVFDGMTEDLIPLYAVGVFIPFTLAQFGMVIKWIHERPKNWLSKLSVNLLGGIVTFIV
                    ************************************************************

    COL             FMILLITKFSQVWPILIFLPFVVIFFLKINKHYRDIAEQLRSDIDVLNVDVVDRNLAIVP
    N315            FMILLITKFSQVWPILIFLPFVVIFFLKINKHYRDIAEQLRSDIDVLNVDVVDRNLAIVP
    NCTC8325        FMILLITKFSQVWPILIFLPFVVIFFLKINKHYRDIAEQLRSDIDVLNVDVVDRNLAIVP
    Newman          FMILLITKFSQVWPILIFLPFVVIFFLKINKHYRDIAEQLRSDIDVLNVDVVDRNLAIVP
    USA300_FPR3757  FMILLITKFSQVWPILIFLPFVVIFFLKINKHYRDIAEQLRSDIDVLNVDVVDRNLAIVP
                    ************************************************************

    COL             ITSITTAVDKSIYYAQMLANNDVIAVHVSFGDEDEKAFQEKWKRHFPDVRLVILHSEYRS
    N315            ITSITTAVDKSIYYAQMLANNDVIAVHVSFGDEDEKAFQEKWKRHFPDVRLVILHSEYRS
    NCTC8325        ITSITTAVDKSIYYAQMLANNDVIAVHVSFGDEDEKAFQEKWKRHFPDVRLVILHSEYRS
    Newman          ITSITTAVDKSIYYAQMLANNDVIAVHVSFGDEDEKAFQEKWKRHFPDVRLVILHSEYRS
    USA300_FPR3757  ITSITTAVDKSIYYAQMLANNDVIAVHVSFGDEDEKAFQEKWKRHFPDVRLVILHSEYRS
                    ************************************************************

    COL             IIRPISRFIDKINRKANDQNYMITVVIPEFITKKRWHNLLHNQTSLRMKLYLIYQKNVNV
    N315            IIRPISRFIDKINRKANDQNYMITVVIPEFITKKRWHNLLHNQTSLRMKLYLIYQKNVNV
    NCTC8325        IIRPISRFIDKINRKANDQNYMITVVIPEFITKKRWHNLLHNQTSLRMKLYLIYQKNVNV
    Newman          IIRPISRFIDKINRKANDQNYMITVVIPEFITKKRWHNLLHNQTSLRMKLYLIYQKNVNV
    USA300_FPR3757  IIRPISRFIDKINRKANDQNYMITVVIPEFITKKRWHNLLHNQTSLRMKLYLIYQKNVNV
                    ************************************************************

    COL             CTIPFKLKK
    N315            CTIPFKLKK
    NCTC8325        CTIPFKLKK
    Newman          CTIPFKLKK
    USA300_FPR3757  CTIPFKLKK
                    *********