From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005997000
  • symbol?: opuCD
  • description?: amino acid ABC transporter permease

      descriptions from strain specific annotations:

    • amino acid ABC transporter permease
    • glycine betaine/carnitine/choline transport system permease
    • glycine betaine/carnitine/choline ABC transporter opuCD
    • OsmotiCALL import_20_25_26_pangenomey activated L-carnitine/choline ABC transporter, permease protein OpuCD
    • putative glycine betaine/carnitine/cholinetransport system permease protein
    • betaine-carnitine-choline ABC transporter
    • binding--dependent transport system inner membrane component family protein
    • binding-protein-dependent transport system inner membrane protein
    • glycine betaine/carnitine/choline ABC transporter permease
    • glycine betaine/carnitine/choline transport system permease OpuCD
    • glycine betaine/carnitine/choline transport system permease proteinopuCD
    • glycine betaine/L-proline ABC superfamily ATP binding cassette transporter, membrane protein
    • glycine betaine/L-proline ABC superfamily ATP binding cassette transporter, permease protein
    • glycine betaine/L-proline ABC transporter membrane protein
    • glycine betaine transport system permease
  • strand?: -
  • coordinates?: 6059272..6059967
  • synteny block?: BlockID0047410
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2234 (opuCD)
    NCTC8325:
    Newman:
    NWMN_2344 (opuCD)
    USA300_FPR3757:
    SAUSA300_2390 (opuCd)
    04-02981:
    SA2981_2382 (opuCD)
    08BA02176:
    C248_2495 (opuCD)
    11819-97:
    MS7_2459
    71193:
    ST398NM01_2497
    ECT-R 2:
    ECTR2_2303
    ED133:
    SAOV_2495c
    ED98:
    SAAV_2511
    HO 5096 0412:
    SAEMRSA15_23450 (opuCD)
    JH1:
    SaurJH1_2520
    JH9:
    SaurJH9_2472
    JKD6008:
    SAA6008_02487 (opuCD)
    JKD6159:
    SAA6159_02343 (opuCD)
    LGA251:
    SARLGA251_22260 (opuCD)
    M013:
    M013TW_2408
    MRSA252:
    SAR2535 (opuCD)
    MSHR1132:
    SAMSHR1132_22730
    MSSA476:
    SAS2337
    Mu3:
    SAHV_2429 (opuCD)
    Mu50:
    SAV2445 (opuCD)
    MW2:
    MW2369 (opuCD)
    RF122:
    SAB2327c (opuCD)
    ST398:
    SAPIG2497
    T0131:
    SAT0131_02644 (smc)
    TCH60:
    HMPREF0772_10743 (opuCD)
    TW20:
    SATW20_25740 (opuCD)
    USA300_TCH1516:
    USA300HOU_2434 (opuCD)
    VC40:
    SAVC_11100

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEGNLLQQLFNYYVTNFGYLWDLFFKHLLMSVYGVLFAALIGIPLGILLARYTKLSGFVI
    N315            MEGNLLQQLFNYYVTNFGYLWDLFFKHLLMSVYGVLFAALIGIPLGILLARYTKLSGFVI
    NCTC8325        MEGNLLQQLFNYYVTNFGYLWDLFFKHLLMSVYGVLFAALIGIPLGILLARYTKLSGFVI
    Newman          MEGNLLQQLFNYYVTNFGYLWDLFFKHLLMSVYGVLFAALIGIPLGILLARYTKLSGFVI
    USA300_FPR3757  MEGNLLQQLFNYYVTNFGYLWDLFFKHLLMSVYGVLFAALIGIPLGILLARYTKLSGFVI
                    ************************************************************

    COL             TIANIIQTVPVIAMLAILMLVMGLGSETVVLTVFLYALLPIIKNTYTGIASVDANIKDAG
    N315            TIANIIQTVPVIAMLAILMLVMGLGSETVVLTVFLYALLPIIKNTYTGIASVDANIKDAG
    NCTC8325        TIANIIQTVPVIAMLAILMLVMGLGSETVVLTVFLYALLPIIKNTYTGIASVDANIKDAG
    Newman          TIANIIQTVPVIAMLAILMLVMGLGSETVVLTVFLYALLPIIKNTYTGIASVDANIKDAG
    USA300_FPR3757  TIANIIQTVPVIAMLAILMLVMGLGSETVVLTVFLYALLPIIKNTYTGIASVDANIKDAG
                    ************************************************************

    COL             KGMGMTRNQVLRMIELPLSVSVIIGGIRIALVVAIGVVAVGSFIGAPTLGDIVIRGTNAT
    N315            KGMGMTRNQVLRMIELPLSVSVIIGGIRIALVVAIGVVAVGSFIGAPTLGDIVIRGTNAT
    NCTC8325        KGMGMTRNQVLRMIELPLSVSVIIGGIRIALVVAIGVVAVGSFIGAPTLGDIVIRGTNAT
    Newman          KGMGMTRNQVLRMIELPLSVSVIIGGIRIALVVAIGVVAVGSFIGAPTLGDIVIRGTNAT
    USA300_FPR3757  KGMGMTRNQVLRMIELPLSVSVIIGGIRIALVVAIGVVAVGSFIGAPTLGDIVIRGTNAT
                    ************************************************************

    COL             DGTTFILAGAIPIAIIAIVIDVLLRFLEKRLDPTTRHRKNQSNHRPQSINM
    N315            DGTTFILAGAIPIAIIAIVIDVLLRFLEKRLDPTTRHRKNQSNHRPQSINM
    NCTC8325        DGTTFILAGAIPIAIIAIVIDVLLRFLEKRLDPTTRHRKNQSNHRPQSINM
    Newman          DGTTFILAGAIPIAIIAIVIDVLLRFLEKRLDPTTRHRKNQSNHRPQSINM
    USA300_FPR3757  DGTTFILAGAIPIAIIAIVIDVLLRFLEKRLDPTTRHRKNQSNHRPQSINM
                    ***************************************************