From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006024000
  • symbol?: cntD
  • description?: oligopeptide transporter ATPase subunit

      descriptions from strain specific annotations:

    • oligopeptide transporter ATPase subunit
    • ABC transporter
    • Oligopeptide transporter putative ATPase domain protein
    • oligopeptide transport ATP-binding protein oppD. domain protein
    • peptide ABC transporter ATP-binding protein
    • oligopeptide ABC transporter ATP-binding protein
    • oligopeptide transporter putative ATPase domain
    • oligopeptide ABC superfamily ATP binding cassette transporter, ABC protein
    • oligopeptide ABC transporter ATP-binding protein Opp-1D
    • ABC transporter family protein
    • dipeptide transport ATP-binding protein DppD
    • nickel transport ATP-binding protein
    • oligopeptide transporter ATPase domain-containing protein
  • strand?: -
  • coordinates?: 6080576..6081391
  • synteny block?: BlockID0047680
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2252 (opp-1D)
    NCTC8325:
    Newman:
    NWMN_2361 (opp1D)
    USA300_FPR3757:
    04-02981:
    SA2981_2401 (opp-1D)
    08BA02176:
    C248_2514 (opp-1D)
    11819-97:
    MS7_2477
    71193:
    ST398NM01_2514
    ECT-R 2:
    ECTR2_2321
    ED133:
    SAOV_2514c
    ED98:
    SAAV_2530
    HO 5096 0412:
    SAEMRSA15_23620 (opp-1D)
    JH1:
    SaurJH1_2540
    JH9:
    SaurJH9_2491
    JKD6008:
    SAA6008_02505 (opp-1D)
    JKD6159:
    SAA6159_02361 (opp-1D)
    LGA251:
    SARLGA251_22440 (opp-1D)
    M013:
    M013TW_2424
    MRSA252:
    SAR2551 (opp-1D)
    MSHR1132:
    SAMSHR1132_22890
    MSSA476:
    SAS2355
    Mu3:
    SAHV_2448
    Mu50:
    SAV2464
    MW2:
    MW2388 (opp-1D)
    RF122:
    SAB2347c (opp1D)
    ST398:
    SAPIG2514
    T0131:
    SAT0131_02663
    TCH60:
    HMPREF0772_10725 (opp-1D)
    TW20:
    SATW20_25920 (opp-1D)
    USA300_TCH1516:
    USA300HOU_2455
    VC40:
    SAVC_11190

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTLLTVKHLTITDTWTDQPLVSDVNFTLTKGETLGVIGESGSGKSITCKSIIGLNPERLG
    N315            MTLLTVKHLTITDTWTDQPLVSDVNFTLTKGETLGVIGESGSGKSITCKSIIGLNPERLG
    NCTC8325        MTLLTVKHLTITDTWTDQPLVSDVNFTLTKGETLGVIGESGSGKSITCKSIIGLNPERLG
    Newman          MTLLTVKHLTITDTWTDQPLVSDVNFTLTKGETLGVIGESGSGKSITCKSIIGLNPERLG
    USA300_FPR3757  MTLLTVKHLTITDTWTDQPLVSDVNFTLTKGETLGVIGESGSGKSITCKSIIGLNPERLG
                    ************************************************************

    COL             VTGEIIFDGTSMLSLSESQLKKYRGKDIAMVMQQGSRAFDPSTTVGKQMFETMKVHTSMS
    N315            VTGEIIFDGTSMLSLSESQRKKYRGKDIAMVMQQGSRAFDPSTTVGKQMFETMKVHTSMS
    NCTC8325        VTGEIIFDGTSMLSLSESQLKKYRGKDIAMVMQQGSRAFDPSTTVGKQMFETMKVHTSMS
    Newman          VTGEIIFDGTSMLSLSESQLKKYRGKDIAMVMQQGSRAFDPSTTVGKQMFETMKVHTSMS
    USA300_FPR3757  VTGEIIFDGTSMLSLSESQLKKYRGKDIAMVMQQGSRAFDPSTTVGKQMFETMKVHTSMS
                    ******************* ****************************************

    COL             TQEIEKTLIEYMDYLSLKDPKRILKSYPYMLSGGMLQRLMIALALALKPKLIIADEPTTA
    N315            TQEIEKTLIEYMDYLSLKDPKRILKSYPYMLSGGMLQRLMIALALALKPKLIIADEPTTA
    NCTC8325        TQEIEKTLIEYMDYLSLKDPKRILKSYPYMLSGGMLQRLMIALALALKPKLIIADEPTTA
    Newman          TQEIEKTLIEYMDYLSLKDPKRILKSYPYMLSGGMLQRLMIALALALKPKLIIADEPTTA
    USA300_FPR3757  TQEIEKTLIEYMDYLSLKDPKRILKSYPYMLSGGMLQRLMIALALALKPKLIIADEPTTA
                    ************************************************************

    COL             LDTITQYDVLEAFIDIKKHFDCAMIFISHDLTVINKIADRVVVMKNGQLIEQGTRESVLH
    N315            LDTITQYDVLEAFIDIKKHFDCAMIFISHDLTVINKIADRVVVMKNGQLIEHGTRESVLH
    NCTC8325        LDTITQYDVLEAFIDIKKHFDCAMIFISHDLTVINKIADRVVVMKNGQLIEQGTRESVLH
    Newman          LDTITQYDVLEAFIDIKKHFDCAMIFISHDLTVINKIADRVVVMKNGQLIEQGTRESVLH
    USA300_FPR3757  LDTITQYDVLEAFIDIKKHFDCAMIFISHDLTVINKIADRVVVMKNGQLIEQGTRESVLH
                    ***************************************************:********

    COL             HPEHVYTKYLLSTKKKINDHFKHVMRGDVHD
    N315            HPEHVYTKYLLSTKKKINDHFKHVMRGDVHD
    NCTC8325        HPEHVYTKYLLSTKKKINDHFKHVMRGDVHD
    Newman          HPEHVYTKYLLSTKKKINDHFKHVMRGDVHD
    USA300_FPR3757  HPEHVYTKYLLSTKKKINDHFKHVMRGDVHD
                    *******************************