From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006028000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 6084949..6086166
  • synteny block?: BlockID0047720
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2405
    08BA02176:
    C248_2518
    11819-97:
    MS7_2481
    71193:
    ST398NM01_2518
    ECT-R 2:
    ECTR2_2325
    ED133:
    SAOV_2518c
    ED98:
    SAAV_2534
    HO 5096 0412:
    SAEMRSA15_23660
    JH1:
    SaurJH1_2544
    JH9:
    SaurJH9_2495
    JKD6008:
    SAA6008_02509
    JKD6159:
    SAA6159_02365
    LGA251:
    SARLGA251_22480
    M013:
    M013TW_2428
    MRSA252:
    SAR2555
    MSHR1132:
    SAMSHR1132_22930
    MSSA476:
    SAS2359
    Mu3:
    SAHV_2452
    Mu50:
    SAV2468
    MW2:
    MW2392
    RF122:
    SAB2351c
    ST398:
    SAPIG2518
    T0131:
    SAT0131_02667 (gid)
    TCH60:
    HMPREF0772_10721
    TW20:
    SATW20_25960
    USA300_TCH1516:
    USA300HOU_2459
    VC40:
    SAVC_11210

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -----------------------------MVGRASTSEKSKRLYQAYKKEKQFEVKIQNE
    N315            MSKLLMIGTGPVAIQLANICYLKSDYEIDMVGRASTSEKSKRLYQAYKKEKQFEVKIQNE
    NCTC8325        -----------------------------MVGRASTSEKSKRLYQAYKKEKQFEVKIQNE
    Newman          MSKLLMIGTGPVAIQLANICYLKSDYEIDMVGRASTSEKSKRLYQAYKKEKQFEVKIQNE
    USA300_FPR3757  -----------------------------MVGRASTSEKSKRLYQAYKKAKQFEVKIQNE
                                                 ******************** **********

    COL             AHQHLEGKFEINRLYKDVKNVKGEYETVVMACTADAYYDTLQQLSLETLQSVKHVILISP
    N315            AHQHLEGKFEINRLYKDVKNVKGEYETVVMACTADAYYDTLQQLSLETLQSVKHVILISP
    NCTC8325        AHQHLEGKFEINRLYKDVKNVKGEYETVVMACTADAYYDTLQQLSLETLQSVKHVILISP
    Newman          AHQHLEGKFEINRLYKDVKNVKGEYETVVMACTADAYYDTLQQLSLETLQSVKHVILISP
    USA300_FPR3757  AHQHLEGKFEINRLYKDVKNVKGEYETVVMACTADAYYDTLQQLSLETLQSVKHVILISP
                    ************************************************************

    COL             TFGSQMIVEQFMSKFNKDIEVISFSTYLGDTRIVDKEAPNHVLTTGVKKKLYMGSTHSNS
    N315            TFGSQMIVEQFMSKFSQDIEVISFSTYLGDTRIVDKEAPNHVLTTGVKKKLYMGSTHSNS
    NCTC8325        TFGSQMIVEQFMSKFNKDIEVISFSTYLGDTRIVDKEAPNHVLTTGVKKKLYMGSTHSNS
    Newman          TFGSQMIVEQFMSKFNKDIEVISFSTYLGDTRIVDKEAPNHVLTTGVKKKLYMGSTHSNS
    USA300_FPR3757  TFGSQMIVEQFMSKFNKDIEVISFSTYLGDTRIVDKEAPNHVLTTGVKKKLYMGSTHSNS
                    ***************.:*******************************************

    COL             TMCQRISALAEQLKIQLEVVESPLHAETRNSSLYVHPPLFMNDFSLKAIFEGTDVPVYVY
    N315            TMCQRISALAEQLKIQLEVVESPLHAETRNSSLYVHPPLFMNDFSLKAIFEGTDVPVYVY
    NCTC8325        TMCQRISALAEQLKIQLEVVESPLHAETRNSSLYVHPPLFMNDFSLKAIFEGTDVPVYVY
    Newman          TMCQRISALAEQLKIQLEVVESPLHAETRNSSLYVHPPLFMNDFSLKAIFEGTDVPVYVY
    USA300_FPR3757  TMCQRISALAEQLKIQLEVVESPLHAETRNSSLYVHPPLFMNDFSLKAIFEGTDVPVYVY
                    ************************************************************

    COL             KLFPEGPITMTLIREMRLMWKEMMVILQAFRVPSVNLLQFMVKENYPVRPETLDEGDIEH
    N315            KLFPEGPITMTLIREMRLMWKEMMAILQAFRVPSVNLLQFMVKENYPVRPETLDEGDIEH
    NCTC8325        KLFPEGPITMTLIREMRLMWKEMMVILQAFRVPSVNLLQFMVKENYPVRPETLDEGDIEH
    Newman          KLFPEGPITMTLIREMRLMWKEMMVILQAFRVPSVNLLQFMVKENYPVRPETLDEGDIEH
    USA300_FPR3757  KLFPEGPITMTLIREMRLMWKEMMVILQAFRVPSVNLLQFMVKENYPVRPETLDEGDIEH
                    ************************.***********************************

    COL             FEILPDILQEYLLYVRYTAILIDPFSQPDENGHYFDFSAVPFKQVYKNEQDVVQIPRMPS
    N315            FEILPDILQEYLLYVRYTAILIDPFSQPDENGHYFDFSAVPFKQVYKNEQDVVQIPRMPS
    NCTC8325        FEILPDILQEYLLYVRYTAILIDPFSQPDENGHYFDFSAVPFKQVYKNEQDVVQIPRMPS
    Newman          FEILPDILQEYLLYVRYTAILIDPFSQPDENGHYFDFSAVPFKQVYKNEQDVVQIPRMPS
    USA300_FPR3757  FEILPDILQEYLLYVRYTAILIDPFSQPDENGHYFDFSAVPFKQVYKNEQDVVQIPRMPS
                    ************************************************************

    COL             EDYYRTAMIQHIGKMLGIKTPMIDQFLTRYEASCQAYKDMHQDQHLSSQFNTNLFEGDKA
    N315            EDYYRTAMIQHIGKMLGIKTPMIDQFLTRYEASCQAYKDMHQDQQLSSQFNTNLFEGDKA
    NCTC8325        EDYYRTAMIQHIGKMLGIKTPMIDQFLTRYEASCQAYKDMHQDQHLSSQFNTNLFEGDKA
    Newman          EDYYRTAMIQHIGKMLGIKTPMIDQFLTRYEASCQAYKDMHQDQHLSSQFNTNLFEGDKA
    USA300_FPR3757  EDYYRTAMIQHIGKMLGIKTPMIDQFLTRYEASCQAYKDMHQDQHLSSQFNTNLFEGDKA
                    ********************************************:***************

    COL             LVTKFLEINRTLS
    N315            LVTKFLEINRTLS
    NCTC8325        LVTKFLEINRTLS
    Newman          LVTKFLEINRTLS
    USA300_FPR3757  LVTKFLEINRTLS
                    *************