From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006030000
  • symbol?: dapF
  • description?: diaminopimelate epimerase

      descriptions from strain specific annotations:

    • diaminopimelate epimerase
    • diaminopimelate epimerase family protein
    • diaminopimelate epimerase-like protein
  • strand?: -
  • coordinates?: 6087075..6087848
  • synteny block?: BlockID0047740
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2407
    08BA02176:
    C248_2520
    11819-97:
    MS7_2483
    71193:
    ST398NM01_2520
    ECT-R 2:
    ECTR2_2327
    ED133:
    SAOV_2520c
    ED98:
    SAAV_2536
    HO 5096 0412:
    SAEMRSA15_23680
    JH1:
    SaurJH1_2546
    JH9:
    SaurJH9_2497
    JKD6008:
    SAA6008_02511 (dapF)
    JKD6159:
    SAA6159_02367 (dapF)
    LGA251:
    SARLGA251_22500
    M013:
    M013TW_2430
    MRSA252:
    SAR2557
    MSHR1132:
    SAMSHR1132_22950
    MSSA476:
    SAS2361
    Mu3:
    SAHV_2454
    Mu50:
    SAV2470
    MW2:
    MW2394
    RF122:
    SAB2353c
    ST398:
    SAPIG2520
    T0131:
    SAT0131_02669 (hslV)
    TCH60:
    HMPREF0772_10719 (dapF)
    TW20:
    SATW20_25980
    USA300_TCH1516:
    USA300HOU_2461
    VC40:
    SAVC_11220

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNRQVIEFSKYNPSGNMTILVHSKHDASEYASIANQLMAATHVCCEQVGFIESTQNDDGN
    N315            MNRQVIEFSKYNPSGNMTILVHSKHDASEYASIANQLMAATHVCCEQVGFIESTQNDDGN
    NCTC8325        MNRQVIEFSKYNPSGNMTILVHSKHDASEYASIANQLMAATHVCCEQVGFIESTQNDDGN
    Newman          MNRQVIEFSKYNPSGNMTILVHSKHDASEYASIANQLMAATHVCCEQVGFIESTQNDDGN
    USA300_FPR3757  MNRQVIEFSKYNPSGNMTILVHSKHDASEYASIANQLMAATHVCCEQVGFIESTQNDDGN
                    ************************************************************

    COL             DFHLVMSGNEFCGNATMSYIHHLQESHLLKDQQFKVKVSGCSDLVQCAIHDCQYYEVQMP
    N315            DFHLVMSGNEFCGNATMSYIHHLQESHLLKDQQFKVKVSGCSDLVQCAIHDCQYYEVQMP
    NCTC8325        DFHLVMSGNEFCGNATMSYIHHLQESHLLKDQQFKVKVSGCSDLVQCAIHDCQYYEVQMP
    Newman          DFHLVMSGNEFCGNATMSYIHHLQESHLLKDQQFKVKVSGCSDLVQCAIHDCQYYEVQMP
    USA300_FPR3757  DFHLVMSGNEFCGNATMSYIHHLQESHLLKDQQFKVKVSGCSDLVQCAIHDCQYYEVQMP
                    ************************************************************

    COL             QAHRVVPTTINMGNHSWKAIEIIYETYVHYVIPVKQVTTEIQHLVEAFVREQQWSHKYKT
    N315            QAHRVVPTTINMGNHSWKALEIIYETYVHYVIPVKQVTTEIQHLVEAFVREQQWSHKYKT
    NCTC8325        QAHRVVPTTINMGNHSWKAIEIIYETYVHYVIPVKQVTTEIQHLVEAFVREQQWSHKYKT
    Newman          QAHRVVPTTINMGNHSWKAIEIIYETYVHYVIPVKQVTTEIQHLVEAFVREQQWSHKYKT
    USA300_FPR3757  QAHRVVPTTINMGNHSWKAIEIIYETYVHYVIPVKQVTTEIQHLVEAFVREQQWSHKYKT
                    *******************:****************************************

    COL             VGMMLFDEQRQFLQPLIYIPEIQSLIWENSCGSGTASIGVFNNYQRNDACKDFTVHQPGG
    N315            VGMMLFDEQRQFLQPLIYIPEIQSLIWENSCGSGTASIGVFNNYQRNDACKDFTVHQPGG
    NCTC8325        VGMMLFDEQRQFLQPLIYIPEIQSLIWENSCGSGTASIGVFNNYQRNDACKDFTVHQPGG
    Newman          VGMMLFDEQRQFLQPLIYIPEIQSLIWENSCGSGTASIGVFNNYQRNDACKDFTVHQPGG
    USA300_FPR3757  VGMMLFDEQRQFLQPLIYIPEIQSLIWENSCGSGTASIGVFNNYQRNDACKDFTVHQPGG
                    ************************************************************

    COL             SILVTSKRCHQLGYQTSIKGQVTTVATGKAYIE
    N315            SILVTSKRCHQLGYQTSIKGQVTTVATGKAYIE
    NCTC8325        SILVTSKRCHQLGYQTSIKGQVTTVATGKAYIE
    Newman          SILVTSKRCHQLGYQTSIKGQVTTVATGKAYIE
    USA300_FPR3757  SILVTSKRCHQLGYQTSIKGQVTTVATGKAYIE
                    *********************************