From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006038000
  • symbol?:
  • description?: alkylhydroperoxidase

      descriptions from strain specific annotations:

    • alkylhydroperoxidase
    • putative carboxymuconolactone decarboxylase
    • Alkylhydroperoxidase like protein, AhpD family
    • carboxymuconolactone decarboxylase family protein
    • transposase
    • AhpD family alkylhydroperoxidase
  • strand?: -
  • coordinates?: 6093661..6094083
  • synteny block?: BlockID0047820
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2411
    08BA02176:
    C248_2524
    11819-97:
    MS7_2487
    71193:
    ST398NM01_2524
    ECT-R 2:
    ECTR2_2331
    ED133:
    SAOV_2524c
    ED98:
    SAAV_2540
    HO 5096 0412:
    SAEMRSA15_23720
    JH1:
    SaurJH1_2551
    JH9:
    SaurJH9_2501
    JKD6008:
    SAA6008_02515
    JKD6159:
    SAA6159_02371
    LGA251:
    SARLGA251_22540
    M013:
    M013TW_2434
    MRSA252:
    SAR2561
    MSHR1132:
    SAMSHR1132_22990
    MSSA476:
    SAS2365
    Mu3:
    SAHV_2458
    Mu50:
    SAV2474
    MW2:
    MW2398
    RF122:
    SAB2357c
    ST398:
    SAPIG2524
    T0131:
    SAT0131_02673 (rpsB)
    TCH60:
    HMPREF0772_10715
    TW20:
    SATW20_26020
    USA300_TCH1516:
    USA300HOU_2465
    VC40:
    SAVC_11245

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPYNYKKQNGELMSVMSQGEKFIHQSPVNDELSALIKLLISKINGCHYCVDIHKKELKEL
    N315            MPYNYKKQNGELMSVMSQGEKFIHQSPVNDELSALIKLLISKINGCHYCVDIHKKELKEL
    NCTC8325        MPYNYKKQNGELMSVMSQGEKFIHQSPVNDELSALIKLLISKINGCHYCVDIHKKELKEL
    Newman          MPYNYKKQNGELMSVMSQGEKFIHQSPVNDELSALIKLLISKINGCHYCVDIHKKELKEL
    USA300_FPR3757  MPYNYKKQNGELMSVMSQGEKFIHQSPVNDELSALIKLLISKINGCHYCVDIHKKELKEL
                    ************************************************************

    COL             GVTQMKIDEVLSFRHLDLFTDQEKVTLEFAEMLNSIKDFKKFEIIDRLKSFYDEEQIIDL
    N315            GVTQMKIDEVLSFRHLDLFTDQEKVTLEFAEMLNSIKDFKKFEIIDRLKSFYDEEQIIDL
    NCTC8325        GVTQMKIDEVLSFRHLDLFTDQEKVTLEFAEMLNSIKDFKKFEIIDRLKSFYDEEQIIDL
    Newman          GVTQMKIDEVLSFRHLDLFTDQEKVTLEFAEMLNSIKDFKKFEIIDRLKSFYDEEQIIDL
    USA300_FPR3757  GVTQMKIDEVLSFRHLDLFTDQEKVTLEFAEMLNSIKDFKKFEIIDRLKSFYDEEQIIDL
                    ************************************************************

    COL             VFVVNQINGWNRLNIISDRL
    N315            VFVVNQINGWNRLNIISDRL
    NCTC8325        VFVVNQINGWNRLNIISDRL
    Newman          VFVVNQINGWNRLNIISDRL
    USA300_FPR3757  VFVVNQINGWNRLNIISDRL
                    ********************