From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006063000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 6114035..6114226
  • synteny block?: BlockID0048040
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2417
    08BA02176:
    C248_2538
    11819-97:
    MS7_2491
    71193:
    ST398NM01_2538
    ECT-R 2:
    ECTR2_2337
    ED133:
    SAOV_2527c
    ED98:
    SAAV_2546
    HO 5096 0412:
    SAEMRSA15_23800
    JH1:
    SaurJH1_2557
    JH9:
    SaurJH9_2507
    JKD6008:
    SAA6008_02521
    JKD6159:
    SAA6159_02376
    LGA251:
    SARLGA251_22660
    M013:
    M013TW_2441
    MRSA252:
    SAR2569
    MSHR1132:
    SAMSHR1132_23030
    MSSA476:
    SAS2372
    Mu3:
    SAHV_2464
    Mu50:
    SAV2480
    MW2:
    MW2405
    RF122:
    SAB2363c
    ST398:
    SAPIG2538
    T0131:
    SAT0131_02680 (cdsA)
    TCH60:
    HMPREF0772_10707
    TW20:
    SATW20_26070
    USA300_TCH1516:
    USA300HOU_2471
    VC40:
    SAVC_11275

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRKEIEALIFSDVSSYDIYVNTGVNQGLIGDIKDGYLTIDSMPYIDAERLYHFAMERKSL
    N315            MRKEIEALIFSDVSSYDIYVNTGVNQGLIGDIKDGYLTIDSMPYIDAERLYHFAMERKSL
    NCTC8325        MRKEIEALIFSDVSSYDIYVNTGVNQGLIGDIKDGYLTIDSMPYIDAERLYHFAMERKSL
    Newman          MRKEIEALIFSDVSSYDIYVNTGVNQGLIGDIKDGYLTIDSMPYIDAERLYHFAMERKSL
    USA300_FPR3757  MRKEIEALIFSDVSSYDIYVNTGVNQGLIGDIKDGYLTIDSMPYIDAERLYHFAMERKSL
                    ************************************************************

    COL             VTN
    N315            VTN
    NCTC8325        VTN
    Newman          VTN
    USA300_FPR3757  VTN
                    ***