From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006073000
  • symbol?:
  • description?: tandem-type lipoprotein

      descriptions from strain specific annotations:

    • tandem-type lipoprotein
    • tandem lipoprotein
    • lipoprotein
    • Membrane lipoprotein
    • putative lipoprotein
    • staphylococcus tandem lipoproteins family protein
  • strand?: -
  • coordinates?: 6118331..6132694
  • synteny block?: BlockID0048140
  • occurrence?: in 75% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2424
    08BA02176:
    C248_2544
    11819-97:
    71193:
    ST398NM01_2543
    ECT-R 2:
    ECTR2_2344
    ED133:
    ED98:
    SAAV_2554
    HO 5096 0412:
    SAEMRSA15_23870
    JH1:
    SaurJH1_2566
    JH9:
    SaurJH9_2514
    JKD6008:
    SAA6008_02523
    JKD6159:
    SAA6159_02382
    LGA251:
    SARLGA251_22680
    M013:
    M013TW_2449
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_2471
    Mu50:
    SAV2487
    MW2:
    RF122:
    ST398:
    SAPIG2543
    T0131:
    SAT0131_02683 (proS)
    TCH60:
    TW20:
    SATW20_26090
    USA300_TCH1516:
    USA300HOU_2478
    VC40:
    SAVC_11310

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MMIHSKRLRLWLYLVLLAVFIGACGMKKEESSKDKQIKENFNKTLSLYPTKNLEDFYDKE
    N315            MMIHSRKLRLWLYLVLLAVFIGACGMKKEESSKDKQIKENFNKTLSLYPTKNLEDFYDKE
    NCTC8325        -------------------------MKKEESSKDKQIKENFNKTLSLYPTKNLEDFYDKE
    Newman          MMIHSKRLRLWLYLVLLAVFIGACGMKKEESSKDKQIKENFNKTLSLYPTKNLEDFYDKE
    USA300_FPR3757  MMIHSKRLRLWLYLVLLAVFIGACGMKKEESSKDKQIKENFNKTLSLYPTKNLEDFYDKE
                                             ***********************************

    COL             GFRDQEFEKGDKGTWIIHSKMTIETNGKNMESRGLVLYVDRNTRTTKGEFIVRELWEDKK
    N315            GFRDEEFEKGDKGTWIIHSKMTIETNGKNMESRGLVLYVDRNTRTTKGEFIVRELWEDKK
    NCTC8325        GFRDQEFEKGDKGTWIIHSKMTIETNGKNMESRGLVLYVDRNTRTTKGEFIVRELWEDKK
    Newman          GFRDQEFEKGDKGTWIIHSKMTIETNGKNMESRGLVLYVDRNTRTTKGEFIVRELWEDKK
    USA300_FPR3757  GFRDQEFEKGDKGTWIIHSKMTIETNGKNMESRGLVLYVDRNTRTTKGEFIVRELWEDKK
                    ****:*******************************************************

    COL             GYSRSKEKEYPVKMEHNKIIPTKPIADDKLRKEIENFKFFVQYGDFKDINDYKDGDISYN
    N315            GYSRSKEKEYPVKMEHNKIIPTKPIADDKLRKEIEDFKFFVQYGDFKDINDYKDGDISYN
    NCTC8325        GYSRSKEKEYPVKMEHNKIIPTKPIADDKLRKEIENFKFFVQYGDFKDINDYKDGDISYN
    Newman          GYSRSKEKEYPVKMEHNKIIPTKPIADDKLRKEIENFKFFVQYGDFKDINDYKDGDISYN
    USA300_FPR3757  GYSRSKEKEYPVKMEHNKIIPTKPIADDKLRKEIENFKFFVQYGDFKDINDYKDGDISYN
                    ***********************************:************************

    COL             PNVPSYSAKYQLSNDDYNVKQLRKRYDIPTKKAPKLLIKGDGDLKGSSIGHKNLEFTFIE
    N315            PNVPSYSAKYQLSNNDYNVKQLRKRYDIPTKKAPKLLLKGDGDLKGSSIGHKNLEFIFIE
    NCTC8325        PNVPSYSAKYQLSNDDYNVKQLRKRYDIPTKKAPKLLIKGDGDLKGSSIGHKNLEFTFIE
    Newman          PNVPSYSAKYQLSNDDYNVKQLRKRYDIPTKKAPKLLIKGDGDLKGSSIGHKNLEFTFIE
    USA300_FPR3757  PNVPSYSAKYQLSNDDYNVKQLRKRYDIPTKKAPKLLIKGDGDLKGSSIGHKNLEFTFIE
                    **************:**********************:****************** ***

    COL             NKEENIYFTDSINFKPTE
    N315            NKEENIYFTDSINFKPTE
    NCTC8325        NKEENIYFTDSINFKPTE
    Newman          NKEENIYFTDSINFKPTE
    USA300_FPR3757  NKEENIYFTDSINFKPTE
                    ******************