From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006089000
  • symbol?:
  • description?: (deoxy)nucleoside triphosphate pyrophosphohydrolase

      descriptions from strain specific annotations:

    • (deoxy)nucleoside triphosphate pyrophosphohydrolase
    • MutT/nudix family protein
    • pyrophosphohydrolase
    • hydrolase
    • MutT/NUDIX family hydrolase
    • Mutator mutT protein (7,8-dihydro-8-oxoguanine-triphosphatase)
    • mutator protein mutT
    • NUDIX domain-containing protein
    • NUDIX hydrolase
    • putative NUDIX hydrolase
  • strand?: -
  • coordinates?: 6142043..6142342
  • synteny block?: BlockID0048260
  • occurrence?: in 88% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2426 (mutT)
    08BA02176:
    11819-97:
    MS7_2496
    71193:
    ECT-R 2:
    ECTR2_2346
    ED133:
    SAOV_2535c
    ED98:
    SAAV_2556
    HO 5096 0412:
    SAEMRSA15_23890
    JH1:
    SaurJH1_2568
    JH9:
    SaurJH9_2516
    JKD6008:
    SAA6008_02525
    JKD6159:
    SAA6159_02384
    LGA251:
    SARLGA251_22710
    M013:
    M013TW_2455
    MRSA252:
    SAR2575
    MSHR1132:
    SAMSHR1132_23110
    MSSA476:
    SAS2377
    Mu3:
    SAHV_2474
    Mu50:
    SAV2490
    MW2:
    MW2410
    RF122:
    ST398:
    T0131:
    SAT0131_02685
    TCH60:
    HMPREF0772_10701
    TW20:
    SATW20_26110
    USA300_TCH1516:
    USA300HOU_2481
    VC40:
    SAVC_11325

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKVINVVGAIIFSDNKILCAQRSEKMSLPLMWEFPGGKVEKNETEKDALIREIREEMKC
    N315            MKKVINVVGAIIFSDNKILCAQRSEEMSLPLMWEFPGGKIEKNETEKEALIREIREEMKC
    NCTC8325        MKKVINVVGAIIFSDNKILCAQRSEKMSLPLMWEFPGGKVEKNETEKDALIREIREEMKC
    Newman          MKKVINVVGAIIFSDNKILCAQRSEKMSLPLMWEFPGGKVEKNETEKDALIREIREEMKC
    USA300_FPR3757  MKKVINVVGAIIFSDNKILCAQRSEKMSLPLMWEFPGGKVEKNETEKDALIREIREEMKC
                    *************************:*************:*******:************

    COL             DLIVGDKVITTEHEYDFGIVRLTTYKCTLNKELPTLTEHKSIEWLSINELDKLNWAPADI
    N315            DLIVGDKVITTEHEYDFGIVKLTTYKCTLNKELPTLTEHKSIEWLSINELDKLNWAPADI
    NCTC8325        DLIVGDKVITTEHEYDFGIVRLTTYKCTLNKELPTLTEHKSIEWLSINELDKLNWAPADI
    Newman          DLIVGDKVITTEHEYDFGIVRLTTYKCTLNKELPTLTEHKSIEWLSINELDKLNWAPADI
    USA300_FPR3757  DLIVGDKVITTEHEYDFGIVRLTTYKCTLNKELPTLTEHKSIEWLSINELDKLNWAPADI
                    ********************:***************************************

    COL             PAVNKIMTEG
    N315            PAVNKIMTEG
    NCTC8325        PAVNKIMTEG
    Newman          PAVNKIMTEG
    USA300_FPR3757  PAVNKIMTEG
                    **********