From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006099000
  • symbol?:
  • description?: permease

      descriptions from strain specific annotations:

    • permease
    • transporter protein
    • major facilitator superfamily cation symporter
    • Major Facilitator Superfamily protein
    • major facilitator transporter
    • MFS family major facilitator transporter, cation symporter
  • strand?: -
  • coordinates?: 6149394..6150383
  • synteny block?: BlockID0048360
  • occurrence?: in 75% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2431
    08BA02176:
    11819-97:
    MS7_2499
    71193:
    ECT-R 2:
    ECTR2_2349
    ED133:
    SAOV_2540c
    ED98:
    SAAV_2561
    HO 5096 0412:
    SAEMRSA15_23940
    JH1:
    SaurJH1_2572
    JH9:
    SaurJH9_2520
    JKD6008:
    SAA6008_02530
    JKD6159:
    LGA251:
    M013:
    M013TW_2459
    MRSA252:
    MSHR1132:
    SAMSHR1132_23160
    MSSA476:
    SAS2382
    Mu3:
    SAHV_2479
    Mu50:
    SAV2495
    MW2:
    MW2415
    RF122:
    ST398:
    T0131:
    SAT0131_02691 (nusA)
    TCH60:
    TW20:
    SATW20_26150
    USA300_TCH1516:
    USA300HOU_2485
    VC40:
    SAVC_11350

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLYLEVLKNRNFTYLLIGNFLRRSCFVLFSLQIIWFTVELTNQSSLKLSMMVMSQTLPFI
    N315            MLYLEVLKNRNFTYLLIGNFLRRSCFVLFSLQIIWFTVELTNQSSLKLSMMVMSQTLPFI
    NCTC8325        MLYLEVLKNRNFTYLLIGNFLRRSCFVLFSLQIIWFTVELTNQSSLKLSMMVMSQTLPFI
    Newman          MLYLEVLKNRNFTYLLIGNFLRRSCFVLFSLQIIWFTVELTNQSSLKLSMMVMSQTLPFI
    USA300_FPR3757  MLYLEVLKNRNFTYLLIGNFLRRSCFVLFSLQIIWFTVELTNQSSLKLSMMVMSQTLPFI
                    ************************************************************

    COL             IFGIFGGAYSDKHNKKKILYLSDLILSLIIIIIPLLAITSNLNYLTLLTISTAITIINCY
    N315            IFGIFGGAYSDKHNKKKILYLSDLILSLIIIIIPLLAITSNLNYLTLLTISTAITIINCY
    NCTC8325        IFGIFGGAYSDKHNKKKILYLSDLILSLIIIIIPLLAITSNLNYLTLLTISTAITIINCY
    Newman          IFGIFGGAYSDKHNKKKILYLSDLILSLIIIIIPLLAITSNLNYLTLLTISTAITIINCY
    USA300_FPR3757  IFGIFGGAYSDKHNKKKILYLSDLILSLIIIIIPLLAITSNLNYLTLLTISTAITIINCY
                    ************************************************************

    COL             TDPAFRAILPEIIDEEHLATSNALIDSLQRGSNIILPALIGVIVILVGNVGVFFICSILL
    N315            TDPAFRAILPEIIDEEHLATSNALIDSLQRGSNIILPALIGVIVILVGNVGVFFICSILL
    NCTC8325        TDPAFRAILPEIIDEEHLATSNALIDSLQRGSNIILPALIGVIVILVGNVGVFFICSILL
    Newman          TDPAFRAILPEIIDEEHLATSNALIDSLQRGSNIILPALIGVIVILVGNVGVFFICSILL
    USA300_FPR3757  TDPAFRAILPEIIDEEHLATSNALIDSLQRGSNIILPALIGVIVILVGNVGVFFICSILL
                    ************************************************************

    COL             FLGFIFNALLKYTNNNMIDRHSKEDFSETWEFLKQSKEIPFIIIIQFACILINTGLWRVV
    N315            FLGFIFNALLKYTNNNMIDRHSKEDFSETWEFLKQSKEIPFIIIIQFACILINTGLWRVA
    NCTC8325        FLGFIFNALLKYTNNNMIDRHSKEDFSETWEFLKQSKEIPFIIIIQFACILINTGLWRVV
    Newman          FLGFIFNALLKYTNNNMIDRHSKEDFSETWEFLKQSKEIPFIIIIQFACILINTGLWRVV
    USA300_FPR3757  FLGFIFNALLKYTNNNMIDRHSKEDFSETWEFLKQSKEIPFIIIIQFACILINTGLWRVV
                    ***********************************************************.

    COL             LPLFISNILKEGVGVYGLATSCLGIASLLMSLIMGLLSEKRLIFKFSIGVLVWGIGLSII
    N315            LPLFISNILKEGVGVYGLATSCLGIASLLMSLIMGLLSEKRLIFKFSIGVLVWGIGLSII
    NCTC8325        LPLFISNILKEGVGVYGLATSCLGIASLLMSLIMGLLSEKRLIFKFSIGVLVWGIGLSII
    Newman          LPLFISNILKEGVGVYGLATSCLGIASLLMSLIMGLLSEKRLIFKFSIGVLVWGIGLSII
    USA300_FPR3757  LPLFISNILKEGVGVYGLATSCLGIASLLMSLIMGLLSEKRLIFKFSIGVLVWGIGLSII
                    ************************************************************

    COL             NVFPSVAILYIGATLLGLGQSIEGLTRSVAIQIKTPNHLMGKVFSISSTSNYAADTLSLG
    N315            NVFPSVAILYIGATLVGLGQSIEGLTRSVAIQIKTPNHLMGKVFSISSTSNYAADTLS--
    NCTC8325        NVFPSVAILYIGATLLGLGQSIEGLTRSVAIQIKTPNHLMGKVFSISSTSNYAADTLSLG
    Newman          NVFPSVAILYIGATLLGLGQSIEGLTRSVAIQIKTPNHLMGKVFSISSTSNYAADTLSLG
    USA300_FPR3757  NVFPSVAILYIGATLLGLGQSIEGLTRSVAIQIKTPNHLMGKVFSISSTSNYAADTLSLG
                    ***************:******************************************  

    COL             LISIIIPLLSLSNIFILGGVIISILSLAGLKFVKKSM
    N315            -------------------------------------
    NCTC8325        LISIIIPLLSLSNIFILGGVIISILSLAGLKFVKKSM
    Newman          LISIIIPLLSLSNIFILGGVIISILSLAGLKFVKKSM
    USA300_FPR3757  LISIIIPLLSLSNIFILGGVIISILSLAGLKFVKKSM