From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN006127000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 6204537..6204739
  • synteny block?: BlockID0048590
  • occurrence?: in 41% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2440
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_2356
    ED133:
    ED98:
    SAAV_2569
    HO 5096 0412:
    SAEMRSA15_24000
    JH1:
    SaurJH1_2579
    JH9:
    SaurJH9_2527
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS2389
    Mu3:
    SAHV_2488
    Mu50:
    SAV2504
    MW2:
    MW2422
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    VC40:
    SAVC_11385

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            ----------------------------------MKGVSRHVFVRIVQAIIMKHLVYCFK
    NCTC8325        MQYIALKHVYFYAENRLKYSESERYKKYIGYFRVMKGVSRHVFVRIVQAIIMKRLVYCFK
                                                      *******************:******

    N315            LDNDEFNLKNKYKKYKPCVTRVYDDLNTIYRYISNNKIIN
    NCTC8325        LDNDEFNLKNKYKKYKPCVTRVSDDLNTIYRYISNNKIIN
                    ********************** *****************