From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006132000
  • symbol?: gntR
  • description?: gluconate operon transcriptional repressor

      descriptions from strain specific annotations:

    • gluconate operon transcriptional repressor
    • GntR family transcriptional regulator
    • gluconate operon transcriptional repressor (P28 protein)
    • bacterial regulatory s, gntR family protein
  • strand?: -
  • coordinates?: 6207926..6208603
  • synteny block?: BlockID0048640
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2516 (gntR)
    N315:
    SA2295 (gntR)
    NCTC8325:
    Newman:
    NWMN_2403 (gntR)
    USA300_FPR3757:
    04-02981:
    SA2981_2443 (gntR)
    08BA02176:
    C248_2559 (gntR)
    11819-97:
    MS7_2510
    71193:
    ST398NM01_2557
    ECT-R 2:
    ECTR2_2359
    ED133:
    SAOV_2548c
    ED98:
    SAAV_2572 (gntR)
    HO 5096 0412:
    SAEMRSA15_24030 (gntR)
    JH1:
    SaurJH1_2582
    JH9:
    SaurJH9_2530
    JKD6008:
    SAA6008_02542 (gntR)
    JKD6159:
    SAA6159_02401 (gntR)
    LGA251:
    SARLGA251_22800 (gntR)
    M013:
    M013TW_2472
    MRSA252:
    SAR2584 (gntR)
    MSHR1132:
    SAMSHR1132_23250
    MSSA476:
    SAS2392
    Mu3:
    SAHV_2491 (gntR)
    Mu50:
    SAV2507 (gntR)
    MW2:
    MW2425 (gntR)
    RF122:
    SAB2379c (gntR)
    ST398:
    SAPIG2557
    T0131:
    SAT0131_02705
    TCH60:
    HMPREF0772_10690 (gntR)
    TW20:
    SATW20_26260 (gntR)
    USA300_TCH1516:
    USA300HOU_2494 (gntR)
    VC40:
    SAVC_11400

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MMYGYPEKWLEGMTTGEGIAAELRLGIVNGHIAEGTLLTENQMAKQFNVSRSPIRDAFKL
    N315            MMYGYPEKWLEGMTTGEGIAAELRLGIVNGHIAEGTLLTENQMAKQFNVSRSPIRDAFKL
    NCTC8325        MMYGYPEKWLEGMTTGEGIAAELRLGIVNGHIAEGTLLTENQMAKQFNVSRSPIRDAFKL
    Newman          MMYGYPEKWLEGMTTGEGIAAELRLGIVNGHIAEGTLLTENQMAKQFNVSRSPIRDAFKL
    USA300_FPR3757  MMYGYPEKWLEGMTTGEGIAAELRLGIVNGHIAEGTLLTENQMAKQFNVSRSPIRDAFKL
                    ************************************************************

    COL             LQQNQLIQLERMGAHVLPFGEQEKKEMYDLRLMLESFAFSRVKNQERLPIVKEMKKQLEM
    N315            LQQNQLIQLERMGAHVLPFGEQEKKEMYDLRLMLESFAFSRVKNQERLPIVKEMKKQLEM
    NCTC8325        LQQNQLIQLERMGAHVLPFGEQEKKEMYDLRLMLESFAFSRVKNQERLPIVKEMKKQLEM
    Newman          LQQNQLIQLERMGAHVLPFGEQEKKEMYDLRLMLESFAFSRVKNQERLPIVKEMKKQLEM
    USA300_FPR3757  LQQNQLIQLERMGAHVLPFGEQEKKEMYDLRLMLESFAFSRVKNQERLPIVKEMKKQLEM
                    ************************************************************

    COL             MKVAVKFEDAESFTKHDFEFHETLIKASNHQYLNSFWSHLKPVMMALVLTSMRQRMQQNP
    N315            MKVAVKFEDAESFTKHDFEFHETLIKASNHQYLNSFWSHLKPVMMALVLTSMRQRMQQNP
    NCTC8325        MKVAVKFEDAESFTKHDFEFHETLIKASNHQYLNSFWSHLKPVMMALVLTSMRQRMQQNP
    Newman          MKVAVKFEDAESFTKHDFEFHETLIKASNHQYLNSFWSHLKPVMMALVLTSMRQRMQQNP
    USA300_FPR3757  MKVAVKFEDAESFTKHDFEFHETLIKASNHQYLNSFWSHLKPVMMALVLTSMRQRMQQNP
                    ************************************************************

    COL             QDFERIHHNHQVFIDAVEQYDSQILKEAFHLNFDDVGKDIEGFWLN
    N315            QDFERIHHNHQVFIDAVEQYDSQILKEAFHLNFDDVGKDIEGFWLN
    NCTC8325        QDFERIHHNHQVFIDAVEQYDSQILKEAFHLNFDDVGKDIEGFWLN
    Newman          QDFERIHHNHQVFIDAVEQYDSQILKEAFHLNFDDVGKDIEGFWLN
    USA300_FPR3757  QDFERIHHNHQVFIDAVEQYDSQILKEAFHLNFDDVGKDIEGFWLN
                    **********************************************