From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006133000
  • symbol?:
  • description?: MerR family transcriptional regulator

      descriptions from strain specific annotations:

    • MerR family transcriptional regulator
    • transcriptional regulator MerR family protein
    • Transcriptional regulator, MerR family
    • merR family regulatory family protein
  • strand?: -
  • coordinates?: 6208757..6209525
  • synteny block?: BlockID0048650
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2444
    08BA02176:
    C248_2560
    11819-97:
    MS7_2511
    71193:
    ST398NM01_2558
    ECT-R 2:
    ECTR2_2360
    ED133:
    SAOV_2549c
    ED98:
    SAAV_2573
    HO 5096 0412:
    SAEMRSA15_24040
    JH1:
    SaurJH1_2583
    JH9:
    SaurJH9_2531
    JKD6008:
    SAA6008_02543
    JKD6159:
    SAA6159_02402
    LGA251:
    SARLGA251_22810
    M013:
    M013TW_2473
    MRSA252:
    SAR2585
    MSHR1132:
    SAMSHR1132_23260
    MSSA476:
    SAS2393
    Mu3:
    SAHV_2492
    Mu50:
    SAV2508
    MW2:
    MW2426
    RF122:
    SAB2380c
    ST398:
    SAPIG2558
    T0131:
    SAT0131_02706
    TCH60:
    HMPREF0772_10689
    TW20:
    SATW20_26270
    USA300_TCH1516:
    USA300HOU_2495
    VC40:
    SAVC_11405

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNYSTGELAKLCNVTTRTIQYYDRKGILKPQGFTEGKRRVYTEQQRQTLELILLLKDLG
    N315            MSNYSTGELAKLCNVTTRTIQYYDRKGILKPQGFTEGKRRVYTEQQRQTLELILLLKDLG
    NCTC8325        MSNYSTGELAKLCNVTTRTIQYYDRKGILKPQGFTEGKRRVYTEQQRQTLELILLLKDLG
    Newman          MSNYSTGELAKLCNVTTRTIQYYDRKGILKPQGFTEGKRRVYTEQQRQTLELILLLKDLG
    USA300_FPR3757  MSNYSTGELAKLCNVTTRTIQYYDRKGILKPQGFTEGKRRVYTEQQRQTLELILLLKDLG
                    ************************************************************

    COL             CALSDIDMLLKGEGTLKTLNTLLTMKQQEINQQVKQQQAVLNKIKNVQYYVNEASTSPIT
    N315            CALSDIDMLLKGEGTLKTLNTLLTMKQQEINQQVKQQQAVLNKIKNVQYYVNEASTSPIT
    NCTC8325        CALSDIDMLLKGEGTLKTLNTLLTMKQQEINQQVKQQQAVLNKIKNVQYYVNEASTSPIT
    Newman          CALSDIDMLLKGEGTLKTLNTLLTMKQQEINQQVKQQQAVLNKIKNVQYYVNEASTSPIT
    USA300_FPR3757  CALSDIDMLLKGEGTLKTLNTLLTMKQQEINQQVKQQQAVLNKIKNVQYYVNEASTSPIT
                    ************************************************************

    COL             HLKDIEHVMSKSAEMKSIRRNIWISAGIIGIIQYSSIISAILMKNKWPFLIALPFMIGYG
    N315            HLKDIEHVMSKSAEMKSIRRNIWISAGIIGIIQYSSIMSSILMKNKWPFLIALPFMNCYG
    NCTC8325        HLKDIEHVMSKSAEMKSIRRNIWISAGIIGIIQYSSIISAILMKNKWPFLIALPFMIGYG
    Newman          HLKDIEHVMSKSAEMKSIRRNIWISAGIIGIIQYSSIISAILMKNKWPFLIALPFMIGYG
    USA300_FPR3757  HLKDIEHVMSKSAEMKSIRRNIWISAGIIGIIQYSSIISAILMKNKWPFLIALPFMIGYG
                    *************************************:*:****************  **

    COL             IGVTFYYQQKVAYLCPNCQHIFSPSLWAVIKAKHTATTRRFECPNCHETHYCIEVPKAHM
    N315            IGVTFYYQQKVAYLCPNCQHIFSPSLWAVIKAKHTATTRRFECPNCHETHYCIEVPKAHM
    NCTC8325        IGVTFYYQQKVAYLCPNCQHIFSPSLWAVIKAKHTATTRRFECPNCHETHYCIEVPKAHM
    Newman          IGVTFYYQQKVAYLCPNCQHIFSPSLWAVIKAKHTATTRRFECPNCHETHYCIEVPKAHM
    USA300_FPR3757  IGVTFYYQQKVAYLCPNCQHIFSPSLWAVIKAKHTATTRRFECPNCHETHYCIEVPKAHM
                    ************************************************************

    COL             STEQLEISHIQHNN
    N315            STEQLEISHIQHNN
    NCTC8325        STEQLEISHIQHNN
    Newman          STEQLEISHIQHNN
    USA300_FPR3757  STEQLEISHIQHNN
                    **************