From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006151000
  • symbol?:
  • description?: ABC transporter permease

      descriptions from strain specific annotations:

    • ABC transporter permease
    • membrane spanning protein
    • ABC-2 transporter family protein
    • ABC superfamily ATP binding cassette transporter, membrane protein
    • ABC transporter ATP-binding protein
    • lantibiotic protection ABC transporter permease subunit
    • Membrane spanning protein, putative
    • potential membrane spanning protein
    • pseudogene
    • putative membrane spanning protein
    • transmembrane protein smpB
  • strand?: +
  • coordinates?: 6223151..6223715
  • synteny block?: BlockID0048810
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2451
    08BA02176:
    C248_2572
    11819-97:
    MS7_2520
    71193:
    ST398NM01_2567
    ECT-R 2:
    ECTR2_2367
    ED133:
    SAOV_2559
    ED98:
    SAAV_2580
    HO 5096 0412:
    SAEMRSA15_24130
    JH1:
    SaurJH1_2590
    JH9:
    SaurJH9_2538
    JKD6008:
    SAA6008_02552
    JKD6159:
    SAA6159_02411
    LGA251:
    SARLGA251_22900
    M013:
    M013TW_2480
    MRSA252:
    SAR2595
    MSHR1132:
    SAMSHR1132_23360
    MSSA476:
    SAS2400
    Mu3:
    SAHV_2499
    Mu50:
    SAV2515
    MW2:
    MW2434
    RF122:
    SAB2389
    ST398:
    SAPIG2567
    T0131:
    SAT0131_02717
    TCH60:
    HMPREF0772_10679
    TW20:
    SATW20_26360
    USA300_TCH1516:
    USA300HOU_2504
    VC40:
    SAVC_11450

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MGTLIKQECFKLFKKKSTFIAPIVFILLMVAQGYIATKYNEIFTPQESFTSAYNGFSWFA
    NCTC8325        MGTLIKQECFKLFKKKSTFIAPIVFILLMVAQGYIATKYNEIFTPQESFTSAYNGFSWFA
    Newman          MGTLIKQECFKLFKKKSTFIAPIVFILLMVAQGYIATKYNEIFTPQESFTSAYNGFSWFA
    USA300_FPR3757  MGTLIKQECFKLFKKKSTFIAPIVFILLMVAQGYIATKYNEIFTPQESFTSAYNGFSWFA
                    ************************************************************

    N315            FLLIIQASTIISMEFHYGTIKNLLYREYSRTTMIVSKIITLFIISLIYFVITIIASIVIG
    NCTC8325        FLLIIQASTIISMEFHYGTIKNLLYREYSRTTMIVSKIITLFIISLIYFVITIIASIVIG
    Newman          FLLIIQASTIISMEFHYGTIKNLLYREYSRTTMIVSKIITLFIISLIYFVITIIASIVIG
    USA300_FPR3757  FLLIIQASTIISMEFHYGTIKNLLYREYSRTTMIVSKIITLFIISLIYFVITIIASIVIG
                    ************************************************************

    N315            SLFFNDLNIFESSGNQLSLLNQLLLVSLGTFVGVWLVLSLTLLLSSATNSTGVAIAVGIV
    NCTC8325        SLFFNDLNIFESSGNQLSLLNQLLLVSLGTFVGVWLVLSLTLLLSSATNSTGVAIAVGIV
    Newman          SLFFNDLNIFESSGNQLSLLNQLLLVSLGTFVGVWLVLSLTLLLSSATNSTGVAIAVGIV
    USA300_FPR3757  SLFFNDLNIFESSGNQLSLLNQLLLVSLGTFVGVWLVLSLTLLLSSATNSTGVAIAVGIV
                    ************************************************************

    N315            FYFASSILAVIQTALLEKIDWLKWNPINMMNIMLQTVEKGFSKSTKLELHELFIGNIAYI
    NCTC8325        FYFASSILAVIQTALLEKIDWLKWNPINMMNIMLQTVEKGFSKSTKLELHELFIGNIAYI
    Newman          FYFASSILAVIQTALLEKIDWLKWNPINMMNIMLQTVEKGFSKSTKLELHELFIGNIAYI
    USA300_FPR3757  FYFASSILAVIQTALLEKIDWLKWNPINMMNIMLQTVEKGFSKSTKLELHELFIGNIAYI
                    ************************************************************

    N315            SIFLILVVFIFKKKNI
    NCTC8325        SIFLILVVFIFKKKNI
    Newman          SIFLILVVFIFKKKNI
    USA300_FPR3757  SIFLILVVFIFKKKNI
                    ****************