From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006161000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • membrane spanning protein
    • membrane protein , putative
  • strand?: +
  • coordinates?: 6233901..6234980
  • synteny block?: BlockID0048860
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2453
    08BA02176:
    C248_2575
    11819-97:
    MS7_2522
    71193:
    ST398NM01_2569
    ECT-R 2:
    ECTR2_2369
    ED133:
    SAOV_2561
    ED98:
    SAAV_2582
    HO 5096 0412:
    SAEMRSA15_24150
    JH1:
    SaurJH1_2592
    JH9:
    SaurJH9_2540
    JKD6008:
    SAA6008_02555
    JKD6159:
    SAA6159_02413
    LGA251:
    SARLGA251_22920
    M013:
    M013TW_2488
    MRSA252:
    SAR2597
    MSHR1132:
    SAMSHR1132_23380
    MSSA476:
    SAS2402
    Mu3:
    SAHV_2501
    Mu50:
    SAV2517
    MW2:
    MW2437
    RF122:
    SAB2391
    ST398:
    SAPIG2569
    T0131:
    SAT0131_02719
    TCH60:
    HMPREF0772_10676
    TW20:
    SATW20_26380
    USA300_TCH1516:
    USA300HOU_2507
    VC40:
    SAVC_11460

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRILKESIIVAFAFVGVVVGAGFATGQEIFQFFTSHGAYSISGIIVTGLLITLGGMVVMH
    N315            MRILKESIIVAFAFVGVVVGAGFATGQEIFQFFTSHGAYSISGIIVTGLLITLGGMVVMH
    NCTC8325        ----------------------------------------------------------MH
    Newman          MRILKESIIVAFAFVGVVVGAGFATGQEIFQFFTSHGAYSISGIIVTGLLITLGGMVVMH
    USA300_FPR3757  ----------------------------------------------------------MH
                                                                              **

    COL             TGHHLKSRNHSDSINYFLYPSIARGFDIILTMFMLSLAIIMTAGGASTIHQSFNLPYWLS
    N315            TGHHLKSRNHSDSINYFLYPSIARGFDIILTMFMLSLAIIMTAGGASTIHQSFNLPYWLS
    NCTC8325        TGHHLKSRNHSDSINYFLYPSIARGFDIILTMFMLSLAIIMTAGGASTIHQSFNLPYWLS
    Newman          TGHHLKSRNHSDSINYFLYPSIARGFDIILTMFMLSLAIIMTAGGASTIHQSFNLPYWLS
    USA300_FPR3757  TGHHLKSRNHSDSINYFLYPSIARGFDIILTMFMLSLAIIMTAGGASTIHQSFNLPYWLS
                    ************************************************************

    COL             ALILVAFILATLFLKFDRLIAVLGGVTPFLIAIVIMIAVYYFTTSHLDFTAANNDAQIHK
    N315            ALILVAFILATLFLKFDRLIAVLGGVTPFLIAIVIMIAVYYFTTSHLDFTAANNDAQIHK
    NCTC8325        ALILVAFILATLFLKFDRLIAVLGGVTPFLIAIVIMIAVYYFTTSHLDFTAANNDAQIHK
    Newman          ALILVAFILATLFLKFDRLIAVLGGVTPFLIAIVIMIAVYYFTTSHLDFTAANNDAQIHK
    USA300_FPR3757  ALILVAFILATLFLKFDRLIAVLGGVTPFLIAIVIMIAVYYFTTSHLDFTAANNDAQIHK
                    ************************************************************

    COL             QKSLSPGWWFDAINYASLQIAAAFSFLSVMGSKVKYRDSTLYGGLIGGLIITFLLMMINL
    N315            QKSLSPGWWFDAINYASLQIAAAFSFLSVMGSKVKYRDSTLYGGLIGGLIITFLLMMINL
    NCTC8325        QKSLSPGWWFDAINYASLQIAAAFSFLSVMGSKVKYRDSTLYGGLIGGLIITFLLMMINL
    Newman          QKSLSPGWWFDAINYASLQIAAAFSFLSVMGSKVKYRDSTLYGGLIGGLIITFLLMMINL
    USA300_FPR3757  QKSLSPGWWFDAINYASLQIAAAFSFLSVMGSKVKYRDSTLYGGLIGGLIITFLLMMINL
                    ************************************************************

    COL             GLISQFDKIKHVDLPTLKLATQMSPSIGIIMSVIMILVIYNTVVGLMYAFASRFSVPFSR
    N315            GLISQFDKIKHVDLPTLKLATQMSPSIGIIMSVIMILVIYNTVVGLMYAFASRFSVPFSR
    NCTC8325        GLISQFDKIKHVDLPTLKLATQMSPSIGIIMSVIMILVIYNTVVGLMYAFASRFSVPFSR
    Newman          GLISQFDKIKHVDLPTLKLATQMSPSIGIIMSVIMILVIYNTVVGLMYAFASRFSVPFSR
    USA300_FPR3757  GLISQFDKIKHVDLPTLKLATQMSPSIGIIMSVIMILVIYNTVVGLMYAFASRFSVPFSR
                    ************************************************************

    COL             RYFIIIITMAVITYISTFIGFISLIGKVFPIMGLFGFILLIPVLYKGLIKRITGKSHID
    N315            RYFIIIITMAVITYISTFIGFISLIGKVFPIMGLFGFILLIPVLYKGLIKRITGKSHID
    NCTC8325        RYFIIIITMAVITYISTFIGFISLIGKVFPIMGLFGFILLIPVLYKGLIKRITGKSHID
    Newman          RYFIIIITMAVITYISTFIGFISLIGKVFPIMGLFGFILLIPVLYKGLIKRITGKSHID
    USA300_FPR3757  RYFIIIITMAVITYISTFIGFISLIGKVFPIMGLFGFILLIPVLYKGLIKRITGKSHID
                    ***********************************************************