From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006163000
  • symbol?:
  • description?: glyoxylase

      descriptions from strain specific annotations:

    • glyoxylase
    • glyoxalase/bleomycin resistance protein/dioxygenase
    • Glyoxalase family protein
    • glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein
    • glyoxylase family protein
    • lactoylglutatione lyase
    • putative dioxygenase
    • pseudogene
  • strand?: -
  • coordinates?: 6235700..6236572
  • synteny block?: BlockID0048880
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2455
    08BA02176:
    C248_2577
    11819-97:
    MS7_2524
    71193:
    ST398NM01_2571
    ECT-R 2:
    ECTR2_2371
    ED133:
    SAOV_2563c
    ED98:
    SAAV_2584
    HO 5096 0412:
    SAEMRSA15_24170
    JH1:
    SaurJH1_2594
    JH9:
    SaurJH9_2542
    JKD6008:
    SAA6008_02557
    JKD6159:
    SAA6159_02415
    LGA251:
    SARLGA251_22940
    M013:
    M013TW_2490
    MRSA252:
    SAR2599
    MSHR1132:
    SAMSHR1132_23400
    MSSA476:
    SAS2404
    Mu3:
    SAHV_2503
    Mu50:
    SAV2519
    MW2:
    MW2439
    RF122:
    SAB2393c
    ST398:
    SAPIG2571
    T0131:
    SAT0131_02721 (cinA)
    TCH60:
    HMPREF0772_10674
    TW20:
    SATW20_26400
    USA300_TCH1516:
    USA300HOU_2509
    VC40:
    SAVC_11470

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MINNHELLGIHHVTAMTDDAERNYKFFTEVLGMRLVKKTVNQDDIYTYHTFFADDVGSAG
    N315            MINNHELLGIHHVTAMTDDAERNYKFFTEVLGMRLVKKTVNQDDIYTYHTFFADDVGSAG
    NCTC8325        --------------------------------MRLVKKTVNQDDIYTYHTFFADDVGSAG
    Newman          MINNHELLGIHHVTAMTDDAERNYKFFTEVLGMRLVKKTVNQDDIYTYHTFFADDVGSAG
    USA300_FPR3757  --------------------------------MRLVKKTVNQDDIYTYHTFFADDVGSAG
                                                    ****************************

    COL             TDMTFFDFPNITKGQAGTNSITRPSFRVPNDDALTYYEQRFDEFGVKHEGIQELFGKKVL
    N315            TDMTFFDFPNITKGQAGTNSITRPSFRVPNDDALMYYEQRFDEFGVKHEGIQELFGKKVL
    NCTC8325        TDMTFFDFPNITKGQAGTNSITRPSFRVPNDDALTYYEQRFDEFGVKHEGIQELFGKKVL
    Newman          TDMTFFDFPNITKGQAGTNSITRPSFRVPNDDALTYYEQRFDEFGVKHEGIQELFGKKVL
    USA300_FPR3757  TDMTFFDFPNITKGQAGTNSITRPSFRVPNDDALTYYEQRFDEFGVKHEGIQELFGKKVL
                    ********************************** *************************

    COL             PFEEVDGQVYQLISDELNEGVAPGVPWKNGPVPVDKAIYGLGPIEIKVSYFDDFKNILET
    N315            PFEEVDGQVYQLISDELNDGVAPGVPWKNGPVPVDKAIYGLGPIEIKVSYFDDFKNILET
    NCTC8325        PFEEVDGQVYQLISDELNEGVAPGVPWKNGPVPVDKAIYGLGPIEIKVSYFDDFKNILET
    Newman          PFEEVDGQVYQLISDELNEGVAPGVPWKNGPVPVDKAIYGLGPIEIKVSYFDDFKNILET
    USA300_FPR3757  PFEEVDGQVYQLISDELNEGVAPGVPWKNGPVPVDKAIYGLGPIEIKVSYFDDFKNILET
                    ******************:*****************************************

    COL             VYGMTTIAHEDNVALLEVGEGGNGGQVILIKDDKGPAARQGYGEVHHVSFRVKDHDAIEA
    N315            VYGMTTIAHEDNVALLEVGEGGNGGQVILIKDDKGPAARQGYGEVHHVSFRVKDHDAIEA
    NCTC8325        VYGMTTIAHEDNVALLEVGEGGNGGQVILIKDDKGPAARQGYGEVHHVSFRVKDHDAIEA
    Newman          VYGMTTIAHEDNVALLEVGEGGNGGQVILIKDDKGPAARQGYGEVHHVSFRVKDHDAIEA
    USA300_FPR3757  VYGMTTIAHEDNVALLEVGEGGNGGQVILIKDDKGPAARQGYGEVHHVSFRVKDHDAIEA
                    ************************************************************

    COL             WATKYKEVGINNSGIVNRFYFEALYARVGHILIEISTDGPGFMEDEPYETLGEGLSLPPF
    N315            WATKYKEVGINNSGIVNRFYFEALYARVGHILIEISTDGPGFMEDEPYETLGEGLSLPPF
    NCTC8325        WATKYKEVGINNSGIVNRFYFEALYARVGHILIEISTDGPGFMEDEPYETLGEGLSLPPF
    Newman          WATKYKEVGINNSGIVNRFYFEALYARVGHILIEISTDGPGFMEDEPYETLGEGLSLPPF
    USA300_FPR3757  WATKYKEVGINNSGIVNRFYFEALYARVGHILIEISTDGPGFMEDEPYETLGEGLSLPPF
                    ************************************************************

    COL             LENKREYIESEVRPFNTKRQHG
    N315            LENKREYIESEIRPFNTKR---
    NCTC8325        LENKREYIESEVRPFNTKRQHG
    Newman          LENKREYIESEVRPFNTKRQHG
    USA300_FPR3757  LENKREYIESEVRPFNTKRQHG
                    ***********:*******