From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006169000
  • symbol?: ddh
  • description?: D-lactate dehydrogenase

      descriptions from strain specific annotations:

    • D-lactate dehydrogenase
    • D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain protein
    • D-specific D-2-hydroxyacid dehydrogenase
    • D-lactate dehydrogenase (D-LDH) (D-specific D-2-hydroxyacid dehydrogenase)
  • strand?: +
  • coordinates?: 6240409..6241473
  • synteny block?: BlockID0048940
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2312 (ddh)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2460 (ddh)
    08BA02176:
    C248_2582 (ddh)
    11819-97:
    MS7_2530
    71193:
    ST398NM01_2576
    ECT-R 2:
    ECTR2_2376
    ED133:
    SAOV_2568
    ED98:
    SAAV_2589
    HO 5096 0412:
    SAEMRSA15_24220 (ddh)
    JH1:
    SaurJH1_2599
    JH9:
    SaurJH9_2547
    JKD6008:
    SAA6008_02562
    JKD6159:
    SAA6159_02420
    LGA251:
    SARLGA251_22990 (ddh)
    M013:
    M013TW_2496
    MRSA252:
    SAR2605 (ddh)
    MSHR1132:
    SAMSHR1132_23450
    MSSA476:
    SAS2410
    Mu3:
    SAHV_2508 (ddh)
    Mu50:
    SAV2524 (ddh)
    MW2:
    MW2444 (ddh)
    RF122:
    SAB2398 (ddh)
    ST398:
    SAPIG2576
    T0131:
    SAT0131_02727
    TCH60:
    HMPREF0772_10669 (ldhD2)
    TW20:
    SATW20_26450 (ddh)
    USA300_TCH1516:
    USA300HOU_2513 (ddh)
    VC40:
    SAVC_11495

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---------------------MTKIMFFGTRDYEKEMALNWGKKNNVEVTTSKELLSSAT
    N315            MYIIFNFTHLLFNLLKARFLIMTKIMFFGTRDYEKEMALNWGKKNNVEVTTSKELLSSAT
    NCTC8325        ------------------------------------MALNWGKKNNVEVTTSKELLSSAT
    Newman          ------------------------------------MALNWGKKNNVEVTTSKELLSSAT
    USA300_FPR3757  MCIIFNFTHLLFNLLKARFLIMTKIMFFGTRDYEKEMALNWGKKNNVEVTTSKELLSSAT
                                                        ************************

    COL             VDQLKDYDGVTTMQFGKLENDVYPKLESYGIKQIAQRTAGFDMYDLDLAKKHNIVISNVP
    N315            VDQLKDYDGVTTMQFGKLENDVYPKLESYGIKQIAQRTAGFDMYDLDLAKKHNIVISNVP
    NCTC8325        VDQLKDYDGVTTMQFGKLENDVYPKLESYGIKQIAQRTAGFDMYDLDLAKKHNIVISNVP
    Newman          VDQLKDYDGVTTMQFGKLENDVYPKLESYGIKQIAQRTAGFDMYDLDLAKKHNIVISNVP
    USA300_FPR3757  VDQLKDYDGVTTMQFGKLENDVYPKLESYGIKQIAQRTAGFDMYDLDLAKKHNIVISNVP
                    ************************************************************

    COL             SYSPETIAEYSVSIALQLVRRFPDIERRVQAHDFTWQAEIMSKPVKNMTVAIIGTGRIGA
    N315            SYSPETIAEYSVSIALQLVRRFPDIERRVQTHDFTWQAEIMSKPVKNMTVAIIGTGRIGA
    NCTC8325        SYSPETIAEYSVSIALQLVRRFPDIERRVQAHDFTWQAEIMSKPVKNMTVAIIGTGRIGA
    Newman          SYSPETIAEYSVSIALQLVRRFPDIERRVQAHDFTWQAEIMSKPVKNMTVAIIGTGRIGA
    USA300_FPR3757  SYSPETIAEYSVSIALQLVRRFPDIERRVQAHDFTWQAEIMSKPVKNMTVAIIGTGRIGA
                    ******************************:*****************************

    COL             ATAKIYAGFGATITAYDAYPNKDLDFLTYKDSVKEAIKDADIISLHVPANKESYHLFDKA
    N315            ATAKIYAGFGATITAYDAYPNKDLDFLTYKDSVKEAIKDADIISLHVPANKESYHLFDKA
    NCTC8325        ATAKIYAGFGATITAYDAYPNKDLDFLTYKDSVKEAIKDADIISLHVPANKESYHLFDKA
    Newman          ATAKIYAGFGATITAYDAYPNKDLDFLTYKDSVKEAIKDADIISLHVPANKESYHLFDKA
    USA300_FPR3757  ATAKIYAGFGATITAYDAYPNKDLDFLTYKDSVKEAIKDADIISLHVPANKESYHLFDKA
                    ************************************************************

    COL             MFDHVKKGAILVNAARGAVINTPDLIAAVNDGTLLGAAIDTYENEAAYFTNDWTNKDIDD
    N315            MFDHVKKGAILVNAARGAVINTPDLIAAVNDGTLLGAAIDTYENEAAYFTNDWTNKDIDD
    NCTC8325        MFDHVKKGAILVNAARGAVINTPDLIAAVNDGTLLGAAIDTYENEAAYFTNDWTNKDIDD
    Newman          MFDHVKKGAILVNAARGAVINTPDLIAAVNDGTLLGAAIDTYENEAAYFTNDWTNKDIDD
    USA300_FPR3757  MFDHVKKGAILVNAARGAVINTPDLIAAVNDGTLLGAAIDTYENEAAYFTNDWTNKDIDD
                    ************************************************************

    COL             KTLLELIEHERILVTPHIAFFSDEAVQNLVEGGLNAALSVINTGTCETRLN
    N315            KTLLELIEHERILVTPHIAFFSDEAVQNLVEGGLNAALSVINTGTCETRLN
    NCTC8325        KTLLELIEHERILVTPHIAFFSDEAVQNLVEGGLNAALSVINTGTCETRLN
    Newman          KTLLELIEHERILVTPHIAFFSDEAVQNLVEGGLNAALSVINTGTCETRLN
    USA300_FPR3757  KTLLELIEHERILVTPHIAFFSDEAVQNLVEGGLNAALSVINTGTCETRLN
                    ***************************************************