From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006176000
  • symbol?:
  • description?: peptide ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • peptide ABC transporter ATP-binding protein
    • ABC transporter ATP-binding protein
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • ABC transporter family protein
    • ABC transporter-like protein
    • ATP-binding ABC transporter
  • strand?: +
  • coordinates?: 6243736..6244371
  • synteny block?: BlockID0049010
  • occurrence?: in 81% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2462
    08BA02176:
    11819-97:
    MS7_2532
    71193:
    ECT-R 2:
    ECTR2_2378
    ED133:
    SAOV_2570
    ED98:
    SAAV_2591
    HO 5096 0412:
    SAEMRSA15_24250
    JH1:
    SaurJH1_2601
    JH9:
    SaurJH9_2549
    JKD6008:
    SAA6008_02564
    JKD6159:
    SAA6159_02422
    LGA251:
    SARLGA251_23010
    M013:
    M013TW_2498
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS2412
    Mu3:
    SAHV_2510
    Mu50:
    SAV2526
    MW2:
    MW2446
    RF122:
    SAB2400
    ST398:
    T0131:
    SAT0131_02729
    TCH60:
    TW20:
    SATW20_26470
    USA300_TCH1516:
    USA300HOU_2515
    VC40:
    SAVC_11505

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLNNYSLKVKNKQLVDNCDLNFYLGQINHIVGKNGVGKSLLAKDFLLNNSGNIPKSISQ
    N315            MKLNNYSLKVKNKQLVDNCDLNFYLGQINHIVGKNGVGKSLLAKDFLLNNSGNIPKSISQ
    NCTC8325        MKLNNYSLKVKNKQLVDNCDLNFYLGQINHIVGKNGVGKSLLAKDFLLNNSGNIPKSISQ
    Newman          MKLNNYSLKVKNKQLVDNCDLNFYLGQINHIVGKNGVGKSLLAKDFLLNNSGNIPKSISQ
    USA300_FPR3757  MKLNNYSLKVKNKQLVDNCDLNFYLGQINHIVGKNGVGKSLLAKDFLLNNSGNIPKSISQ
                    ************************************************************

    COL             NVTLISSSSNIPNDITKDFLLSLLKSKFENNRQTFDKIYNILNIEAIPSNVLLKNLSDGQ
    N315            NVTLISSSSNIPNDITKDFLLSLLKSKFENNRQTFDKIYNILNIEAIPSNVLLKNLSDGQ
    NCTC8325        NVTLISSSSNIPNDITKDFLLSLLKSKFENNRQTFDKIYNILNIEAIPSNVLLKNLSDGQ
    Newman          NVTLISSSSNIPNDITKDFLLSLLKSKFENNRQTFDKIYNILNIEAIPSNVLLKNLSDGQ
    USA300_FPR3757  NVTLISSSSNIPNDITKDFLLSLLKSKFENNRQTFDKIYNILNIEAIPSNVLLKNLSDGQ
                    ************************************************************

    COL             KQKLKLLSFLLEDHDLIILDEVTNALDKKTVNEIYEFLNDFIQSHQTKTIINITHNLSDL
    N315            KQKLKLLSFLLEDHDLIILDEVTNALDKKTVNEIYEFLNDFIQSHQTKTIINITHNLSDL
    NCTC8325        KQKLKLLSFLLEDHDLIILDEVTNALDKKTVNEIYEFLNDFIQSHQTKTIINITHNLSDL
    Newman          KQKLKLLSFLLEDHDLIILDEVTNALDKKTVNEIYEFLNDFIQSHQTKTIINITHNLSDL
    USA300_FPR3757  KQKLKLLSFLLEDHDLIILDEVTNALDKKTVNEIYEFLNDFIQSHQTKTIINITHNLSDL
                    ************************************************************

    COL             SALPGKYFIFKDLQIEEYQSKEEVINDYINL
    N315            SALPGKYFIFKDLQIEEYQSKEEVINDYINL
    NCTC8325        SALPGKYFIFKDLQIEEYQSKEEVINDYINL
    Newman          SALPGKYFIFKDLQIEEYQSKEEVINDYINL
    USA300_FPR3757  SALPGKYFIFKDLQIEEYQSKEEVINDYINL
                    *******************************