From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006177000
  • symbol?:
  • description?: Antibiotic transport system permease

      descriptions from strain specific annotations:

    • Antibiotic transport system permease
    • ABC-2 transporter family protein
  • strand?: +
  • coordinates?: 6244377..6245108
  • synteny block?: BlockID0049020
  • occurrence?: in 78% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2463
    08BA02176:
    11819-97:
    MS7_2533
    71193:
    ECT-R 2:
    ECTR2_2379
    ED133:
    ED98:
    SAAV_2592
    HO 5096 0412:
    SAEMRSA15_24260
    JH1:
    SaurJH1_2602
    JH9:
    SaurJH9_2550
    JKD6008:
    SAA6008_02565
    JKD6159:
    SAA6159_02423
    LGA251:
    SARLGA251_23020
    M013:
    M013TW_2499
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS2413
    Mu3:
    SAHV_2511
    Mu50:
    SAV2527
    MW2:
    MW2447
    RF122:
    SAB2401
    ST398:
    T0131:
    SAT0131_02730
    TCH60:
    TW20:
    SATW20_26480
    USA300_TCH1516:
    USA300HOU_2516
    VC40:
    SAVC_11510

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSTLKLEFKKSISNKIIYTLVVLFTFLFLLGYFLPIGIDKVKSLSYSQFFFSSYTVATQL
    N315            ---MKLEFKKSISNKIIYTLGVLFIFLFLLGYFLPIGIDKVKNLSYGQFFFSSYTVATEF
    NCTC8325        MSTLKLEFKKSISNKIIYTLVVLFTFLFLLGYFLPIGIDKVKSLSYSQFFFSSYTVATQL
    Newman          MSTLKLEFKKSISNKIIYTLVVLFTFLFLLGYFLPIGIDKVKSLSYSQFFFSSYTVATQL
    USA300_FPR3757  MSTLKLEFKKSISNKIIYTLVVLFTFLFLLGYFLPIGIDKVKSLSYSQFFFSSYTVATQL
                       :**************** *** *****************.***.***********::

    COL             GFLLFSFVIAYFINKEYSNKNILFYKLIGDNIFTFFYKKVAVLFFECLVFIILSITIISI
    N315            GFLLFSFVIAYFINKEYSNKNILFYKLIGDNIFTFFYKKVAVLFIECLIYIILGITIISI
    NCTC8325        GFLLFSFVIAYFINKEYSNKNILFYKLIGDNIFTFFYKKVAVLFFECLVFIILSITIISI
    Newman          GFLLFSFVIAYFINKEYSNKNILFYKLIGDNIFTFFYKKVAVLFFECLVFIILSITIISI
    USA300_FPR3757  GFLLFSFVIAYFINKEYSNKNILFYKLIGDNIFTFFYKKVAVLFFECLVFIILSITIISI
                    ********************************************:***::***.******

    COL             IYSDFSHYLLLIILFSLVILQYILVVGTISMVSPNILISLGISIVYWIGSVILVAINKNI
    N315            IYSDFSHYLLLIILFSLVILQYILVVGTISMVSPNILISLGISIVYWIGSVILVAINKNI
    NCTC8325        IYSDFSHYLLLIILFSLVILQYILVVGTISMVSPNILISLGISIVYWIGSVILVAINKNI
    Newman          IYSDFSHYLLLIILFSLVILQYILVVGTISMVSPNILISLGISIVYWIGSVILVAINKNI
    USA300_FPR3757  IYSDFSHYLLLIILFSLVILQYILVVGTISMVSPNILISLGISIVYWIGSVILVAINKNI
                    ************************************************************

    COL             FGIVAPFEASNTMYRAVEKILNNESTFMCPTEIINIVSFFVLLFIVNTIVLLLSRKRWLK
    N315            FGIVAPFEASNTMYRAVEKILNNESTFICPTEIINTVSFFVLLFIVNTIVLLLSRKRWLK
    NCTC8325        FGIVAPFEASNTMYRAVEKILNNESTFMCPTEIINIVSFFVLLFIVNTIVLLLSRKRWLK
    Newman          FGIVAPFEASNTMYRAVEKILNNESTFMCPTEIINIVSFFVLLFIVNTIVLLLSRKRWLK
    USA300_FPR3757  FGIVAPFEASNTMYRAVEKILNNESTFMCPTEIINIVSFFVLLFIVNTIVLLLSRKRWLK
                    ***************************:******* ************************

    COL             IGM
    N315            IGM
    NCTC8325        IGM
    Newman          IGM
    USA300_FPR3757  IGM
                    ***