From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006183000
  • symbol?: sdaAA
  • description?: L-serine dehydratase

      descriptions from strain specific annotations:

    • L-serine dehydratase
    • L-serine dehydratase, iron-sulfur-dependent subunit alpha
    • L-serine dehydratase, iron-sulfur-dependent, alpha subunit
    • L-serine dehydratase, alpha subunit
    • L-serine dehydratase subunit alpha
    • L-serine ammonia-lyase alpha subunit
    • L-serine dehydratase alpha subunit
    • putative L-serine dehydratase, alpha chain
    • 2-hydroxymethylglutarate dehydratase
  • strand?: -
  • coordinates?: 6247537..6248436
  • synteny block?: BlockID0049080
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2544 (sdaAA)
    N315:
    NCTC8325:
    Newman:
    NWMN_2429 (sdhA)
    USA300_FPR3757:
    SAUSA300_2469 (sdaAA)
    04-02981:
    SA2981_2466
    08BA02176:
    C248_2588
    11819-97:
    MS7_2536 (sdaAA)
    71193:
    ST398NM01_2581
    ECT-R 2:
    ECTR2_2382 (sdaAA)
    ED133:
    SAOV_2574c
    ED98:
    SAAV_2596 (sdaAA)
    HO 5096 0412:
    SAEMRSA15_24290
    JH1:
    SaurJH1_2606
    JH9:
    SaurJH9_2554
    JKD6008:
    SAA6008_02568 (sdaAA)
    JKD6159:
    SAA6159_02426 (sdaAA)
    LGA251:
    SARLGA251_23050
    M013:
    M013TW_2502
    MRSA252:
    SAR2610
    MSHR1132:
    SAMSHR1132_23500
    MSSA476:
    SAS2416
    Mu3:
    SAHV_2514
    Mu50:
    SAV2530
    MW2:
    MW2451
    RF122:
    SAB2404c
    ST398:
    SAPIG2581 (sdaAA)
    T0131:
    SAT0131_02735 (porA)
    TCH60:
    HMPREF0772_10661 (sdaAA)
    TW20:
    SATW20_26510
    USA300_TCH1516:
    USA300HOU_2521 (sdhA2)
    VC40:
    SAVC_11525

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFDSIRETIDYAVENNMSFADIMVKEEMELSGKSRDEVRAQMKQNLDVMRDAVIKGTTGD
    N315            MFDSIRETIDYAVENNMSFADIMVKEEMELSGKSRDEVRAQMKQNLDVMRDAVIKGTTGD
    NCTC8325        MFDSIRETIDYAVENNMSFADIMVKEEMELSGKSRDEVRAQMKQNLDVMRDAVIKGTTGD
    Newman          MFDSIRETIDYAVENNMSFADIMVKEEMELSGKSRDEVRAQMKQNLDVMRDAVIKGTTGD
    USA300_FPR3757  MFDSIRETIDYAVENNMSFADIMVKEEMELSGKSRDEVRAQMKQNLDVMRDAVIKGTTGD
                    ************************************************************

    COL             GVESVTGYTGHDAAKLRDYNETHHALSGYEMIDAVKGAIATNEVNAAMGIICATPTAGSS
    N315            GVESVTGYTGHDAAKLRDYNETHHALSGYEMIDAVKGAIATNEVNAAMGIICATPTAGSS
    NCTC8325        GVESVTGYTGHDAAKLRDYNETHHALSGYEMIDAVKGAIATNEVNAAMGIICATPTAGSS
    Newman          GVESVTGYTGHDAAKLRDYNETHHALSGYEMIDAVKGAIATNEVNAAMGIICATPTAGSS
    USA300_FPR3757  GVESVTGYTGHDAAKLRDYNETHHALSGYEMIDAVKGAIATNEVNAAMGIICATPTAGSS
                    ************************************************************

    COL             GTIPGALFKLEKTHDLTEEQMIDFLFTSALFGRVVANNASVAGATGGCQAEVGSASAMAA
    N315            GTIPGALFKLEKTHDLTEEQMIDFLFTSALFGRVVANNASVAGATGGCQAEVGSASAMAA
    NCTC8325        GTIPGALFKLEKTHDLTEEQMIDFLFTSALFGRVVANNASVAGATGGCQAEVGSASAMAA
    Newman          GTIPGALFKLEKTHDLTEEQMIDFLFTSALFGRVVANNASVAGATGGCQAEVGSASAMAA
    USA300_FPR3757  GTIPGALFKLEKTHDLTEEQMIDFLFTSALFGRVVANNASVAGATGGCQAEVGSASAMAA
                    ************************************************************

    COL             AAAVAIFGGSPEASGHAMALAISNLLGLVCDPVAGLVEIPCVMRNAIGSGNALISADLAL
    N315            AAAVAIFGGSPEASGHAMALAISNLLGLVCDPVAGLVEIPCVMRNAIGSGNALISADLAL
    NCTC8325        AAAVAIFGGSPEASGHAMALAISNLLGLVCDPVAGLVEIPCVMRNAIGSGNALISADLAL
    Newman          AAAVAIFGGSPEASGHAMALAISNLLGLVCDPVAGLVEIPCVMRNAIGSGNALISADLAL
    USA300_FPR3757  AAAVAIFGGSPEASGHAMALAISNLLGLVCDPVAGLVEIPCVMRNAIGSGNALISADLAL
                    ************************************************************

    COL             AGIESRIPVDEVIEAMDKVGRNLPASLRETGLGGLAGTPTGEAIKRKIFGTAEDMVKNN
    N315            AGIESRIPVDEVIEAMDKVGRNLPASLRETGLGGLAGTPTGEAIKRKIFGTAEDMVKNN
    NCTC8325        AGIESRIPVDEVIEAMDKVGRNLPASLRETGLGGLAGTPTGEAIKRKIFGTAEDMVKNN
    Newman          AGIESRIPVDEVIEAMDKVGRNLPASLRETGLGGLAGTPTGEAIKRKIFGTAEDMVKNN
    USA300_FPR3757  AGIESRIPVDEVIEAMDKVGRNLPASLRETGLGGLAGTPTGEAIKRKIFGTAEDMVKNN
                    ***********************************************************