From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006185000
  • symbol?:
  • description?: regulatory protein pfoR

      descriptions from strain specific annotations:

    • regulatory protein pfoR
    • PfoR family transcriptional regulator
    • perfringolysin O regulator protein, putative
    • phosphotransferase system fructose-specific IIC component-like protein
    • Transcriptional regulator pfoR
    • surface-exposed regulatory protein
  • strand?: -
  • coordinates?: 6249133..6250128
  • synteny block?: BlockID0049100
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2468 (pfoR)
    08BA02176:
    C248_2590
    11819-97:
    MS7_2538
    71193:
    ST398NM01_2583
    ECT-R 2:
    ECTR2_2384
    ED133:
    SAOV_2576c
    ED98:
    SAAV_2598
    HO 5096 0412:
    SAEMRSA15_24310
    JH1:
    SaurJH1_2608
    JH9:
    SaurJH9_2556
    JKD6008:
    SAA6008_02570
    JKD6159:
    SAA6159_02428
    LGA251:
    SARLGA251_23070
    M013:
    M013TW_2504
    MRSA252:
    SAR2612
    MSHR1132:
    SAMSHR1132_23520
    MSSA476:
    SAS2418
    Mu3:
    SAHV_2516
    Mu50:
    SAV2532
    MW2:
    MW2453
    RF122:
    SAB2406c
    ST398:
    SAPIG2583
    T0131:
    SAT0131_02738
    TCH60:
    HMPREF0772_10659 (pfoR2)
    TW20:
    SATW20_26530
    USA300_TCH1516:
    USA300HOU_2523
    VC40:
    SAVC_11535

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDILLGVGTLVLVLVIMTLFLKYAPYGKQGLQALSGAACATFLPQAFLSYAIGGVFDIKF
    N315            MDILLGVGTLVLVLVIMTLFLKYAPYGKQGLQALSGAACATFLPQAFLSYAIGGVFDIKF
    NCTC8325        ----------------MTLFLKYAPYGKQGLQALSGAACATFLPQAFLSYAIGGVFDIKF
    Newman          MDILLGVGTLVLVLVIMTLFLKYAPYGKQGLQALSGAACATFLPQAFLSYAIGGVFDIKF
    USA300_FPR3757  MDILLGVGTLVLVLVIMTLFLKYAPYGKQGLQALSGAACATFLPQAFLSYAIGGVFDIKF
                                    ********************************************

    COL             LQDIGDLAGSLSGIAVGILTCLNLGVAPVFAVIVGLVLHDFKLLPAFIAAYGVAFLIKWI
    N315            LQDIGDLAGSLSGIAVGILTCLNLGVAPVFAVIVGLVLHDFKLLPAFIAAYCVAFLIKWI
    NCTC8325        LQDIGDLAGSLSGIAVGILTCLNLGVAPVFAVIVGLVLHDFKLLPAFIAAYGVAFLIKWI
    Newman          LQDIGDLAGSLSGIAVGILTCLNLGVAPVFAVIVGLVLHDFKLLPAFIAAYGVAFLIKWI
    USA300_FPR3757  LQDIGDLAGSLSGIAVGILTCLNLGVAPVFAVIVGLVLHDFKLLPAFIAAYGVAFLIKWI
                    *************************************************** ********

    COL             EKKVPEGLDLIVVILFAPAIAFGLASIITPGVLATLKQIGSAVTAVGDNNPYALAVILGL
    N315            EKKVPEGLDLIVVILFAPAIAFGLASIITPGVLATLKQIGSAVTAVGDNNPYALAVILGL
    NCTC8325        EKKVPEGLDLIVVILFAPAIAFGLASIITPGVLATLKQIGSAVTAVGDNNPYALAVILGL
    Newman          EKKVPEGLDLIVVILFAPAIAFGLASIITPGVLATLKQIGSAVTAVGDNNPYALAVILGL
    USA300_FPR3757  EKKVPEGLDLIVVILFAPAIAFGLASIITPGVLATLKQIGSAVTAVGDNNPYALAVILGL
                    ************************************************************

    COL             VIPVTGMTPLSSMVLTSLLGLTGVPMAIGALTCTGSSFVNLILFRKLNIGGPSKAFAVCI
    N315            VIPVTGMTPLSSMVLTSLLGLTGVPMAIGALTCTGSSFVNLILFRKLNIGGPSKAFAVCI
    NCTC8325        VIPVTGMTPLSSMVLTSLLGLTGVPMAIGALTCTGSSFVNLILFRKLNIGGPSKAFAVCI
    Newman          VIPVTGMTPLSSMVLTSLLGLTGVPMAIGALTCTGSSFVNLILFRKLNIGGPSKAFAVCI
    USA300_FPR3757  VIPVTGMTPLSSMVLTSLLGLTGVPMAIGALTCTGSSFVNLILFRKLNIGGPSKAFAVCI
                    ************************************************************

    COL             EPLTQIDLIAQYPVQLYGTNALIGVVNACIVTFSGLVIGVKGMATPIAGAIVLFGFNNAV
    N315            EPLTQIDLIAQYPVQLYGTNALIGVVNACIVTFSGLVIGVKGMATPIAGAIVLFGFNNAV
    NCTC8325        EPLTQIDLIAQYPVQLYGTNALIGVVNACIVTFSGLVIGVKGMATPIAGAIVLFGFNNAV
    Newman          EPLTQIDLIAQYPVQLYGTNALIGVVNACIVTFSGLVIGVKGMATPIAGAIVLFGFNNAV
    USA300_FPR3757  EPLTQIDLIAQYPVQLYGTNALIGVVNACIVTFSGLVIGVKGMATPIAGAIVLFGFNNAV
                    ************************************************************

    COL             TSIVTIATVIIVSIVLAYIIGTLINKFNLMNINFKMPSKKNHIKESV
    N315            TSIVTIATVIIVSIVLAYIIGTLINKFNLMNINFKMPSKKNHIKESV
    NCTC8325        TSIVTIATVIIVSIVLAYIIGTLINKFNLMNINFKMPSKKNHIKESV
    Newman          TSIVTIATVIIVSIVLAYIIGTLINKFNLMNINFKMPSKKNHIKESV
    USA300_FPR3757  TSIVTIATVIIVSIVLAYIIGTLINKFNLMNINFKMPSKKNHIKESV
                    ***********************************************