From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006189000
  • symbol?:
  • description?: alpha/beta hydrolase domain-containing protein

      descriptions from strain specific annotations:

    • alpha/beta hydrolase domain-containing protein
    • Esterase/lipase
    • alpha/beta hydrolase fold family protein
    • Alpha/beta hydrolase fold-3 domain-containing protein
    • esterase
    • esterase, putative
    • exported protein
    • hydrolase (putative secreted protein)
  • strand?: -
  • coordinates?: 6252146..6253114
  • synteny block?: BlockID0049140
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2471
    08BA02176:
    C248_2592
    11819-97:
    MS7_2540
    71193:
    ST398NM01_2585
    ECT-R 2:
    ECTR2_2387
    ED133:
    SAOV_2579c
    ED98:
    SAAV_2601
    HO 5096 0412:
    SAEMRSA15_24340
    JH1:
    SaurJH1_2611
    JH9:
    SaurJH9_2558
    JKD6008:
    SAA6008_02572 (aes)
    JKD6159:
    SAA6159_02431 (aes)
    LGA251:
    SARLGA251_23100
    M013:
    M013TW_2507
    MRSA252:
    SAR2615
    MSHR1132:
    SAMSHR1132_23550
    MSSA476:
    SAS2421
    Mu3:
    SAHV_2519
    Mu50:
    SAV2535
    MW2:
    MW2456
    RF122:
    SAB2409c
    ST398:
    SAPIG2585
    T0131:
    SAT0131_02740 (miaB)
    TCH60:
    HMPREF0772_10656
    TW20:
    SATW20_26560
    USA300_TCH1516:
    USA300HOU_2525
    VC40:
    SAVC_11550

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRKKWSTLAFGFLVAAYAHIRIKEKRSVKSYMLEQGIRLSRAKRRFMYKEEAMKALEKMA
    N315            MRKKWSTLAFGFLVAAYAHIRIKEKRSVKSYMLEQGIRLSRAKRRFMYKEEAMKALEKMA
    NCTC8325        MRKKWSTLAFGFLVAAYAHIRIKEKRSVKSYMLEQGIRLSRAKRRFMYKEEAMKALEKMA
    Newman          MRKKWSTLAFGFLVAAYAHIRIKEKRSVKSYMLEQGIRLSRAKRRFMYKEEAMKALEKMA
    USA300_FPR3757  MRKKWSTLAFGFLVAAYAHIRIKEKRSVKSYMLEQGIRLSRAKRRFMYKEEAMKALEKMA
                    ************************************************************

    COL             PQTAGEYEGTNYQFKMPVKVDKHFGSTVYTVNDKQDKHQRVVLYAHGGAWFQDPLKIHFE
    N315            PQTAGEYEGTNYQFKMPVTVDKHYGSTVYNVNDKQDKHQRVVLYAHGGAWFQDPLKIHFE
    NCTC8325        PQTAGEYEGTNYQFKMPVKVDKHFGSTVYTVNDKQDKHQRVVLYAHGGAWFQDPLKIHFE
    Newman          PQTAGEYEGTNYQFKMPVKVDKHFGSTVYTVNDKQDKHQRVVLYAHGGAWFQDPLKIHFE
    USA300_FPR3757  PQTAGEYEGTNYQFKMPVKVDKHFGSTVYTVNDKQDKHQRVVLYAHGGAWFQDPLKIHFE
                    ******************.****:*****.******************************

    COL             FIDELAETLNAKVIMPVYPKIPHQDYQATYVLFEKLYHDLLNQVADSKQIVVMGDSAGGQ
    N315            FIDELAETLNAKVIMPVYPKIPHQDYQATYVLFEKLYHDLLNQVADSKQIVVMGDSAGGQ
    NCTC8325        FIDELAETLNAKVIMPVYPKIPHQDYQATYVLFEKLYHDLLNQVADSKQIVVMGDSAGGQ
    Newman          FIDELAETLNAKVIMPVYPKIPHQDYQATYVLFEKLYHDLLNQVADSKQIVVMGDSAGGQ
    USA300_FPR3757  FIDELAETLNAKVIMPVYPKIPHQDYQATYVLFEKLYHDLLNQVADSKQIVVMGDSAGGQ
                    ************************************************************

    COL             IALSFAQLLKEKHIVQPGHIVLISPVLDATMQHPEIPDYLKKDPMVGVDGSVFLAEQWAG
    N315            IALSFAQLLKEKHIVQPGHIVLISPVLDATMQHPEIPDYLKKDPMVGVDGSVFLAEQWAG
    NCTC8325        IALSFAQLLKEKHIVQPGHIVLISPVLDATMQHPEIPDYLKKDPMVGVDGSVFLAEQWAG
    Newman          IALSFAQLLKEKHIVQPGHIVLISPVLDATMQHPEIPDYLKKDPMVGVDGSVFLAEQWAG
    USA300_FPR3757  IALSFAQLLKEKHIVQPGHIVLISPVLDATMQHPEIPDYLKKDPMVGVDGSVFLAEQWAG
                    ************************************************************

    COL             DTPLDNYKVSPINGDLDGLGRITLTVGTKEVLYPDALNLSQLLSAKGIEHDFIPGYYQFH
    N315            DTPLDNYKVSPINGDLDGLGRITLTVGTKEVLYPDALNLSQLLSAKGIEHDFIPGYYQFH
    NCTC8325        DTPLDNYKVSPINGDLDGLGRITLTVGTKEVLYPDALNLSQLLSAKGIEHDFIPGYYQFH
    Newman          DTPLDNYKVSPINGDLDGLGRITLTVGTKEVLYPDALNLSQLLSAKGIEHDFIPGYYQFH
    USA300_FPR3757  DTPLDNYKVSPINGDLDGLGRITLTVGTKEVLYPDALNLSQLLSAKGIEHDFIPGYYQFH
                    ************************************************************

    COL             IYPVFPIPERRRFLYQVKNIIN
    N315            IYPVFPIPERRRFLYQVKNIIN
    NCTC8325        IYPVFPIPERRRFLYQVKNIIN
    Newman          IYPVFPIPERRRFLYQVKNIIN
    USA300_FPR3757  IYPVFPIPERRRFLYQVKNIIN
                    **********************