From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006191000
  • symbol?:
  • description?: acyl-CoA thioester hydrolase

      descriptions from strain specific annotations:

    • acyl-CoA thioester hydrolase
    • thioesterase-like protein
    • thioesterase superfamily protein
  • strand?: -
  • coordinates?: 6253647..6254057
  • synteny block?: BlockID0049160
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2473
    08BA02176:
    C248_2594
    11819-97:
    MS7_2542
    71193:
    ST398NM01_2587
    ECT-R 2:
    ECTR2_2389
    ED133:
    SAOV_2581c
    ED98:
    SAAV_2603
    HO 5096 0412:
    SAEMRSA15_24360
    JH1:
    SaurJH1_2613
    JH9:
    SaurJH9_2560
    JKD6008:
    SAA6008_02574
    JKD6159:
    SAA6159_02433
    LGA251:
    SARLGA251_23120
    M013:
    M013TW_2509
    MRSA252:
    SAR2617
    MSHR1132:
    SAMSHR1132_23570
    MSSA476:
    SAS2423
    Mu3:
    SAHV_2521
    Mu50:
    SAV2537
    MW2:
    MW2458
    RF122:
    SAB2411c
    ST398:
    SAPIG2587
    T0131:
    SAT0131_02742
    TCH60:
    HMPREF0772_10654
    TW20:
    SATW20_26580
    USA300_TCH1516:
    USA300HOU_2527
    VC40:
    SAVC_11560

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTTEGLLVAEKEIEVNGYDIDAMGVVSNIVYIRWFEDLRTAFINQHMNYSTMINQGISPI
    N315            MTTEGLLVAEKEIEVNGYDIDAMGVVSNIVYIRWFEDLRTAFINQHMNYSTMINQGISPI
    NCTC8325        MTTEGLLVAEKEIEVNGYDIDAMGVVSNIVYIRWFEDLRTAFINQHMNYSTMINQGISPI
    Newman          MTTEGLLVAEKEIEVNGYDIDAMGVVSNIVYIRWFEDLRTAFINQHMNYSTMINQGISPI
    USA300_FPR3757  MTTEGLLVAEKEIEVNGYDIDAMGVVSNIVYIRWFEDLRTAFINQHMNYSTMINQGISPI
                    ************************************************************

    COL             LMKTEAEYKVPVTIHDKPVGRIYLVKASKMKWVFQFEIVSAHGVHCIGTQTGGFYRLSDK
    N315            LMKTEAEYKVPVTIHDKPVGRIYLVKASKMKWVFQFEIVSAHCVHCIGTQTGGFYRLSDK
    NCTC8325        LMKTEAEYKVPVTIHDKPVGRIYLVKASKMKWVFQFEIVSAHGVHCIGTQTGGFYRLSDK
    Newman          LMKTEAEYKVPVTIHDKPVGRIYLVKASKMKWVFQFEIVSAHGVHCIGTQTGGFYRLSDK
    USA300_FPR3757  LMKTEAEYKVPVTIHDKPVGRIYLVKASKMKWVFQFEIVSAHGVHCIGTQTGGFYRLSDK
                    ****************************************** *****************

    COL             KITSVPQVFQDILATK
    N315            KITSVPQVFQDILATK
    NCTC8325        KITSVPQVFQDILATK
    Newman          KITSVPQVFQDILATK
    USA300_FPR3757  KITSVPQVFQDILATK
                    ****************