From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006195000
  • symbol?: glcB
  • description?: PTS glucoside EIICBA component

      descriptions from strain specific annotations:

    • PTS glucoside EIICBA component
    • PTS system glucose-specific transporter subunit IIABC
    • PTS system, IIABC components
    • PTS system, glucose-specific IIABC component
    • phosphotransferase system, glucose-specific IIABC component
    • PTS family glucose/glucoside (glc) porter component IIABC
    • pts system, glucose-specific iibc component
    • PTS system, glucose-specific IIBC subunit
    • PTS system, glucose-specific IICBA component
    • PTS system, glucose-specific IIC component / PTS system, glucose-specific IIB component / PTS system, glucose-specific IIA component
    • PTS system glucose-specific IIABC component
    • PTS system glucose-specific transporter subunit IICBA
    • PTS system glucoside-specific EIICBA component
  • strand?: -
  • coordinates?: 6256206..6258272
  • synteny block?: BlockID0049190
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2326 (ptsG)
    NCTC8325:
    Newman:
    NWMN_2437 (ptsG)
    USA300_FPR3757:
    04-02981:
    SA2981_2474 (ptsG)
    08BA02176:
    C248_2595 (glcB)
    11819-97:
    MS7_2543 (glcB)
    71193:
    ST398NM01_2588
    ECT-R 2:
    ECTR2_2390 (ptsG)
    ED133:
    SAOV_2582c
    ED98:
    SAAV_2604
    HO 5096 0412:
    SAEMRSA15_24410 (glcB)
    JH1:
    SaurJH1_2614
    JH9:
    SaurJH9_2561
    JKD6008:
    SAA6008_02575
    JKD6159:
    SAA6159_02434
    LGA251:
    SARLGA251_23130 (glcB)
    M013:
    M013TW_2510
    MRSA252:
    SAR2618 (glcB)
    MSHR1132:
    SAMSHR1132_23580
    MSSA476:
    SAS2424
    Mu3:
    SAHV_2522 (ptsG)
    Mu50:
    SAV2538 (ptsG)
    MW2:
    MW2459 (ptsG)
    RF122:
    SAB2412c (glcB)
    ST398:
    SAPIG2588 (ptsG)
    T0131:
    SAT0131_02743 (hexA)
    TCH60:
    HMPREF0772_10653 (glcB)
    TW20:
    SATW20_26590 (glcB)
    USA300_TCH1516:
    USA300HOU_2530 (ptsG)
    VC40:
    SAVC_11565

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFKKLFGQLQRIGKALMLPVAILPAAGILLAFGNAMHNEQLVEIAPWLKNDIIVMISSVM
    N315            MFKKLFGQLQRIGKALMLPVAILPAAGILLAFGNAMHNEQLVEIAPWLKNDIIVMISSVM
    NCTC8325        MFKKLFGQLQRIGKALMLPVAILPAAGILLAFGNAMHNEQLVEIAPWLKNDIIVMISSVM
    Newman          MFKKLFGQLQRIGKALMLPVAILPAAGILLAFGNAMHNEQLVEIAPWLKNDIIVMISSVM
    USA300_FPR3757  MFKKLFGQLQRIGKALMLPVAILPAAGILLAFGNAMHNEQLVEIAPWLKNDIIVMISSVM
                    ************************************************************

    COL             EAAGQVVFDNLPLLFAVGTALGLAGGDGVAALAALVGYLIMNATMGKVLHITIDDIFSYA
    N315            EAAGQVVFDNLPLLFAVGTALGLAGGDGVAALAALVGYLIMNATMGKVLHITIDDIFSYA
    NCTC8325        EAAGQVVFDNLPLLFAVGTALGLAGGDGVAALAALVGYLIMNATMGKVLHITIDDIFSYA
    Newman          EAAGQVVFDNLPLLFAVGTALGLAGGDGVAALAALVGYLIMNATMGKVLHITIDDIFSYA
    USA300_FPR3757  EAAGQVVFDNLPLLFAVGTALGLAGGDGVAALAALVGYLIMNATMGKVLHITIDDIFSYA
                    ************************************************************

    COL             KGAKELSQAAKEPAHALVLGIPTLQTGVFGGIIMGALAAWCYNKFYNITLPPFLGFFAGK
    N315            KGAKELSQAAKEPAHALVLGIPTLQTGVFGGIIMGALAAWCYNKFYNITLPPFLGFFAGK
    NCTC8325        KGAKELSQAAKEPAHALVLGIPTLQTGVFGGIIMGALAAWCYNKFYNITLPPFLGFFAGK
    Newman          KGAKELSQAAKEPAHALVLGIPTLQTGVFGGIIMGALAAWCYNKFYNITLPPFLGFFAGK
    USA300_FPR3757  KGAKELSQAAKEPAHALVLGIPTLQTGVFGGIIMGALAAWCYNKFYNITLPPFLGFFAGK
                    ************************************************************

    COL             RFVPIVTSVVAIATGVLLSFAWPPIQDGLNSLSNFLLNKNLTLTTFIFGIIERSLIPFGL
    N315            RFVPIVTSVVAIATGVLLSFAWPPIQDGLNSLSNFLLNKNLTLTTFIFGIIERSLIPFGL
    NCTC8325        RFVPIVTSVVAIATGVLLSFAWPPIQDGLNSLSNFLLNKNLTLTTFIFGIIERSLIPFGL
    Newman          RFVPIVTSVVAIATGVLLSFAWPPIQDGLNSLSNFLLNKNLTLTTFIFGIIERSLIPFGL
    USA300_FPR3757  RFVPIVTSVVAIATGVLLSFAWPPIQDGLNSLSNFLLNKNLTLTTFIFGIIERSLIPFGL
                    ************************************************************

    COL             HHIFYSPFWFEFGSYTNHAGELVRGDQRIWMAQLKDGVPFTAGAFTTGKYPFMMFGLPAA
    N315            HHIFYSPFWFEFGSYTNHAGELVRGDQRIWMAQLKDGVPFTAGAFTTGKYPFMMFGLPAA
    NCTC8325        HHIFYSPFWFEFGSYTNHAGELVRGDQRIWMAQLKDGVPFTAGAFTTGKYPFMMFGLPAA
    Newman          HHIFYSPFWFEFGSYTNHAGELVRGDQRIWMAQLKDGVPFTAGAFTTGKYPFMMFGLPAA
    USA300_FPR3757  HHIFYSPFWFEFGSYTNHAGELVRGDQRIWMAQLKDGVPFTAGAFTTGKYPFMMFGLPAA
                    ************************************************************

    COL             AFAIYKNARPERKKVVGGLMLSAGLTAFLTGITEPLEFSFLFVAPVLYGIHVLLAGTSFL
    N315            AFAIYKNARPERKKVVGGLMLSAGLTAFLTGITEPLEFSFLFVAPVLYGIHVLLAGTSFL
    NCTC8325        AFAIYKNARPERKKVVGGLMLSAGLTAFLTGITEPLEFSFLFVAPVLYGIHVLLAGTSFL
    Newman          AFAIYKNARPERKKVVGGLMLSAGLTAFLTGITEPLEFSFLFVAPVLYGIHVLLAGTSFL
    USA300_FPR3757  AFAIYKNARPERKKVVGGLMLSAGLTAFLTGITEPLEFSFLFVAPVLYGIHVLLAGTSFL
                    ************************************************************

    COL             VMHLLGVKIGMTFSGGFIDYILYGLLNWDRSHALLVIPVGIVYAIVYYFLFDFAIRKFKL
    N315            VMHLLGVKIGMTFSGGFIDYILYGLLNWDRSHALLVIPVGIVYAIVYYFLFDFAIRKFKL
    NCTC8325        VMHLLGVKIGMTFSGGFIDYILYGLLNWDRSHALLVIPVGIVYAIVYYFLFDFAIRKFKL
    Newman          VMHLLGVKIGMTFSGGFIDYILYGLLNWDRSHALLVIPVGIVYAIVYYFLFDFAIRKFKL
    USA300_FPR3757  VMHLLGVKIGMTFSGGFIDYILYGLLNWDRSHALLVIPVGIVYAIVYYFLFDFAIRKFKL
                    ************************************************************

    COL             KTPGREDEETEIRNSSVAKLPFDVLDAMGGKENIKHLDACITRLRVEVVDKSKVDVAGIK
    N315            KTPGREDEETEIRNSSVAKLPFDVLDAMGGKENIKHLDACITRLRVEVVDKSKVDVAGIK
    NCTC8325        KTPGREDEETEIRNSSVAKLPFDVLDAMGGKENIKHLDACITRLRVEVVDKSKVDVAGIK
    Newman          KTPGREDEETEIRNSSVAKLPFDVLDAMGGKENIKHLDACITRLRVEVVDKSKVDVAGIK
    USA300_FPR3757  KTPGREDEETEIRNSSVAKLPFDVLDAMGGKENIKHLDACITRLRVEVVDKSKVDVAGIK
                    ************************************************************

    COL             ALGASGVLEVGNNMQAIFGPKSDQIKHDMAKIMSGEITKPSETTVTEEMSDEPVHVEALG
    N315            ALGASGVLEVGNNMQAIFGPKSDQIKHDMAKIMSGEITKPSETTVTEEMSDEPVHVEALG
    NCTC8325        ALGASGVLEVGNNMQAIFGPKSDQIKHDMAKIMSGEITKPSETTVTEEMSDEPVHVEALG
    Newman          ALGASGVLEVGNNMQAIFGPKSDQIKHDMAKIMSGEITKPSETTVTEEMSDEPVHVEALG
    USA300_FPR3757  ALGASGVLEVGNNMQAIFGPKSDQIKHDMAKIMSGEITKPSETTVTEEMSDEPVHVEALG
                    ************************************************************

    COL             TTDIYAPGIGQIIPLSEVPDQVFAGKMMGDGVGFIPEKGEIVAPFDGTVKTIFPTKHAIG
    N315            TTDIYAPGVGQIIPLSEVPDQVFAGKMMGDGIGFIPEKGEIVAPFDGTVKTIFPTKHAIG
    NCTC8325        TTDIYAPGIGQIIPLSEVPDQVFAGKMMGDGVGFIPEKGEIVAPFDGTVKTIFPTKHAIG
    Newman          TTDIYAPGIGQIIPLSEVPDQVFAGKMMGDGVGFIPEKGEIVAPFDGTVKTIFPTKHAIG
    USA300_FPR3757  TTDIYAPGIGQIIPLSEVPDQVFAGKMMGDGVGFIPEKGEIVAPFDGTVKTIFPTKHAIG
                    ********:**********************:****************************

    COL             LESESGVEVLIHIGIDTVKLNGEGFESLINVDEKVTQGQPLMKVNLAYLKAHAPSIVTPM
    N315            LESESGVEVLIHIGIDTVKLNGEGFESLINVDEKVTQAQPLMKVNLAYLKAHAPSIVTPM
    NCTC8325        LESESGVEVLIHIGIDTVKLNGEGFESLINVDEKVTQGQPLMKVNLAYLKAHAPSIVTPM
    Newman          LESESGVEVLIHIGIDTVKLNGEGFESLINVDEKVTQGQPLMKVNLAYLKAHAPSIVTPM
    USA300_FPR3757  LESESGVEVLIHIGIDTVKLNGEGFESLINVDEKVTQGQPLMKVNLAYLKAHAPSIVTPM
                    *************************************.**********************

    COL             IITNLENKELVIEDVQDADPGKLIMTVK
    N315            IITNLENKELVIEDVQDADPGKLIMTVK
    NCTC8325        IITNLENKELVIEDVQDADPGKLIMTVK
    Newman          IITNLENKELVIEDVQDADPGKLIMTVK
    USA300_FPR3757  IITNLENKELVIEDVQDADPGKLIMTVK
                    ****************************