From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006196000
  • symbol?: cidC
  • description?: pyruvate oxidase

      descriptions from strain specific annotations:

    • pyruvate oxidase
    • Pyruvate oxidase, CidC / Pyruvate oxidase (ubiquinone, cytochrome)
    • thiamine pyrophosphate enzyme, C-terminal TPP binding domain protein
    • pyruvate dehydrogenase
  • strand?: -
  • coordinates?: 6258574..6260313
  • synteny block?: BlockID0049200
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_2438 (poxB)
    USA300_FPR3757:
    04-02981:
    SA2981_2475 (cidC)
    08BA02176:
    C248_2596
    11819-97:
    MS7_2544
    71193:
    ST398NM01_2589
    ECT-R 2:
    ECTR2_2391
    ED133:
    SAOV_2583c
    ED98:
    SAAV_2605
    HO 5096 0412:
    SAEMRSA15_24420
    JH1:
    SaurJH1_2615
    JH9:
    SaurJH9_2562
    JKD6008:
    SAA6008_02576 (cidC)
    JKD6159:
    SAA6159_02435 (cidC)
    LGA251:
    SARLGA251_23140 (cidC)
    M013:
    M013TW_2511
    MRSA252:
    SAR2619
    MSHR1132:
    SAMSHR1132_23590
    MSSA476:
    SAS2425
    Mu3:
    SAHV_2523
    Mu50:
    SAV2539
    MW2:
    MW2460
    RF122:
    SAB2413c
    ST398:
    SAPIG2589
    T0131:
    SAT0131_02745 (mutL)
    TCH60:
    HMPREF0772_10652 (spxB)
    TW20:
    SATW20_26600 (cidC)
    USA300_TCH1516:
    USA300HOU_2531 (ilvB2)
    VC40:
    SAVC_11570

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKIKANEALVKALQAWDIDHLYGIPGDSIDAVVDSLRTVRDQFKFYHVRHEEVASLAAA
    N315            MAKIKANEALVKALQAWDIDHLYGIPGDSIDAVVDSLRTVRDQFKFYHVRHEEVASLAAA
    NCTC8325        MAKIKANEALVKALQAWDIDHLYGIPGDSIDAVVDSLRTVRDQFKFYHVRHEEVASLAAA
    Newman          MAKIKANEALVKALQAWDIDHLYGIPGDSIDAVVDSLRTVRDQFKFYHVRHEEVASLAAA
    USA300_FPR3757  MAKIKANEALVKALQAWDIDHLYGIPGDSIDAVVDSLRTVRDQFKFYHVRHEEVASLAAA
                    ************************************************************

    COL             GYTKLTGKIGVALSIGGPGLIHLLNGMYDAKMDNVPQLILSGQTNSTALGTKAFQETNLQ
    N315            GYTKLTGKIGVALSIGGPGLIHLLNGMYDAKMDNVPQLILSGQTNSTALGTKAFQETNLQ
    NCTC8325        GYTKLTGKIGVALSIGGPGLIHLLNGMYDAKMDNVPQLILSGQTNSTALGTKAFQETNLQ
    Newman          GYTKLTGKIGVALSIGGPGLIHLLNGMYDAKMDNVPQLILSGQTNSTALGTKAFQETNLQ
    USA300_FPR3757  GYTKLTGKIGVALSIGGPGLIHLLNGMYDAKMDNVPQLILSGQTNSTALGTKAFQETNLQ
                    ************************************************************

    COL             KLCEDVAVYNHQIEKGDNVFEIVNEAIRTAYEQKGVAVVICPNDLLTEKIKDTTNKPVDT
    N315            KLCEDVAVYNHQIEKGDNVFEIVNEAIRTAYEQKGVAVVICPNDLLTEKIKDTTNKPVDT
    NCTC8325        KLCEDVAVYNHQIEKGDNVFEIVNEAIRTAYEQKGVAVVICPNDLLTEKIKDTTNKPVDT
    Newman          KLCEDVAVYNHQIEKGDNVFEIVNEAIRTAYEQKGVAVVICPNDLLTEKIKDTTNKPVDT
    USA300_FPR3757  KLCEDVAVYNHQIEKGDNVFEIVNEAIRTAYEQKGVAVVICPNDLLTEKIKDTTNKPVDT
                    ************************************************************

    COL             SRPTVVSPKYKDIKKAVKLINKSKKPVMLIGVGAKHAKDELREFIEMAKIPVIHSLPAKT
    N315            SRPTVVSPKYKDIKKAVKLINKSKKPVMLIGVGAKHAKDELREFIEMAKIPVIHSLPAKT
    NCTC8325        SRPTVVSPKYKDIKKAVKLINKSKKPVMLIGVGAKHAKDELREFIEMAKIPVIHSLPAKT
    Newman          SRPTVVSPKYKDIKKAVKLINKSKKPVMLIGVGAKHAKDELREFIEMAKIPVIHSLPAKT
    USA300_FPR3757  SRPTVVSPKYKDIKKAVKLINKSKKPVMLIGVGAKHAKDELREFIEMAKIPVIHSLPAKT
                    ************************************************************

    COL             ILPDDHPYSIGNLGKIGTKTSYQTMQEADLLIMVGTNYPYVDYLPKKNIKAIQIDTNPKN
    N315            ILPDDHPYSIGNLGKIGTKTSYQTMQEADLLIMVGTNYPYVDYLPKKNIKAIQIDTNPKN
    NCTC8325        ILPDDHPYSIGNLGKIGTKTSYQTMQEADLLIMVGTNYPYVDYLPKKNIKAIQIDTNPKN
    Newman          ILPDDHPYSIGNLGKIGTKTSYQTMQEADLLIMVGTNYPYVDYLPKKNIKAIQIDTNPKN
    USA300_FPR3757  ILPDDHPYSIGNLGKIGTKTSYQTMQEADLLIMVGTNYPYVDYLPKKNIKAIQIDTNPKN
                    ************************************************************

    COL             IGHRFNINVGIVGDSKIALHQLTENIKHVAERPFLNKTLERKAVWDKWMEQDKNNNSKPL
    N315            IGHRFNINVGIVGDSKIALHQLTENIKHVAERPFLNKTLERKAVWDKWMEQDKNNNSKPL
    NCTC8325        IGHRFNINVGIVGDSKIALHQLTENIKHVAERPFLNKTLERKAVWDKWMEQDKNNNSKPL
    Newman          IGHRFNINVGIVGDSKIALHQLTENIKHVAERPFLNKTLERKAVWDKWMEQDKNNNSKPL
    USA300_FPR3757  IGHRFNINVGIVGDSKIALHQLTENIKHVAERPFLNKTLERKAVWDKWMEQDKNNNSKPL
                    ************************************************************

    COL             RPERLMASINKFIKDDAVISADVGTATVWSTRYLNLGVNNKFIISSWLGTMGCGLPGAIA
    N315            RPERLMASINKFIKDDAVISADVGTATVWSTRYLNLGVNNKFIISSWLGTMGCGLPGAMA
    NCTC8325        RPERLMASINKFIKDDAVISADVGTATVWSTRYLNLGVNNKFIISSWLGTMGCGLPGAIA
    Newman          RPERLMASINKFIKDDAVISADVGTATVWSTRYLNLGVNNKFIISSWLGTMGCGLPGAIA
    USA300_FPR3757  RPERLMASINKFIKDDAVISADVGTATVWSTRYLNLGVNNKFIISSWLGTMGCGLPGAIA
                    **********************************************************:*

    COL             SKIAYPNRQAIAIAGDGAFQMVMQDFATAVQYDLPLTVFVLNNKQLAFIKYEQQAAGELE
    N315            SKIAYPNRQAIAIAGDGAFQMVMQDFATAVQYDLPLTVFVLNNKQLAFIKYEQQAAGELE
    NCTC8325        SKIAYPNRQAIAIAGDGAFQMVMQDFATAVQYDLPLTVFVLNNKQLAFIKYEQQAAGELE
    Newman          SKIAYPNRQAIAIAGDGAFQMVMQDFATAVQYDLPLTVFVLNNKQLAFIKYEQQAAGELE
    USA300_FPR3757  SKIAYPNRQAIAIAGDGAFQMVMQDFATAVQYDLPLTVFVLNNKQLAFIKYEQQAAGELE
                    ************************************************************

    COL             YAVDFSDMDHAKFAEAAGGKGYTIKSASEVDAIVEEALAQDVPTIVDVYVDPNAAPLPGK
    N315            YAVDFSDMDHAKFAEAAGGKGYTIKSASEVDAIVEEALAQDVPTIVDVYVDPNAAPLPGK
    NCTC8325        YAVDFSDMDHAKFAEAAGGKGYTIKSASEVDAIVEEALAQDVPTIVDVYVDPNAAPLPGK
    Newman          YAVDFSDMDHAKFAEAAGGKGYTIKSASEVDAIVEEALAQDVPTIVDVYVDPNAAPLPGK
    USA300_FPR3757  YAVDFSDMDHAKFAEAAGGKGYTIKSASEVDAIVEEALAQDVPTIVDVYVDPNAAPLPGK
                    ************************************************************

    COL             IVNEEALGYGKWAFRSITEDKHLDLDQIPPISVAAKRFL
    N315            IVNEEALGYGKWAFRSITEDKYLDLDQIPPISVAAKRFL
    NCTC8325        IVNEEALGYGKWAFRSITEDKHLDLDQIPPISVAAKRFL
    Newman          IVNEEALGYGKWAFRSITEDKHLDLDQIPPISVAAKRFL
    USA300_FPR3757  IVNEEALGYGKWAFRSITEDKHLDLDQIPPISVAAKRFL
                    *********************:*****************