From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006198000
  • symbol?: cidA
  • description?: holin-like protein cidA

      descriptions from strain specific annotations:

    • holin-like protein cidA
    • LrgA family protein
    • murein hydrolase exporter
    • murein hydrolase regulator LrgA
    • pseudogene
    • putative murein hydrolase subunit LrgA_1
  • strand?: -
  • coordinates?: 6261046..6261387
  • synteny block?: BlockID0049220
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_2440 (cidA)
    USA300_FPR3757:
    04-02981:
    SA2981_2477
    08BA02176:
    C248_2598
    11819-97:
    MS7_2546
    71193:
    ST398NM01_2591
    ECT-R 2:
    ECTR2_2393
    ED133:
    SAOV_2585c
    ED98:
    SAAV_2607
    HO 5096 0412:
    SAEMRSA15_24440
    JH1:
    SaurJH1_2617
    JH9:
    SaurJH9_2564
    JKD6008:
    SAA6008_02578 (lrgA_1)
    JKD6159:
    SAA6159_02437 (lrgA_1)
    LGA251:
    SARLGA251_23160 (cidA)
    M013:
    M013TW_2513
    MRSA252:
    SAR2621
    MSHR1132:
    SAMSHR1132_23610
    MSSA476:
    SAS2427
    Mu3:
    SAHV_2525
    Mu50:
    SAV2541
    MW2:
    MW2462
    RF122:
    SAB2415c
    ST398:
    SAPIG2591
    T0131:
    SAT0131_02747 (glpF)
    TCH60:
    HMPREF0772_10650 (lrgA2)
    TW20:
    SATW20_26620 (cidA)
    USA300_TCH1516:
    USA300HOU_2533
    VC40:
    SAVC_11580

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE
    N315            MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE
    NCTC8325        MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE
    Newman          MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE
    USA300_FPR3757  MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE
                    ************************************************************

    COL             DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK
    N315            DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK
    NCTC8325        DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK
    Newman          DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK
    USA300_FPR3757  DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK
                    ************************************************************

    COL             HKHRKGVDAYE
    N315            HKHRKGVDAYE
    NCTC8325        HKHRKGVDAYE
    Newman          HKHRKGVDAYE
    USA300_FPR3757  HKHRKGVDAYE
                    ***********