Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006200000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 6262739..6262957
  • synteny block?: BlockID0049240
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2479
    08BA02176:
    C248_2600
    11819-97:
    MS7_2548
    71193:
    ST398NM01_2593
    ECT-R 2:
    ECTR2_2395
    ED133:
    SAOV_2587
    ED98:
    SAAV_2609
    HO 5096 0412:
    SAEMRSA15_24460
    JH1:
    SaurJH1_2619
    JH9:
    SaurJH9_2566
    JKD6008:
    JKD6159:
    SAA6159_02439
    LGA251:
    SARLGA251_23180
    M013:
    M013TW_2515
    MRSA252:
    SAR2623
    MSHR1132:
    SAMSHR1132_23630
    MSSA476:
    SAS2429
    Mu3:
    SAHV_2527
    Mu50:
    SAV2543
    MW2:
    MW2464
    RF122:
    SAB2417
    ST398:
    SAPIG2593
    T0131:
    TCH60:
    HMPREF0772_10648
    TW20:
    SATW20_26640
    USA300_TCH1516:
    USA300HOU_2535
    VC40:
    SAVC_11590

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSFYEFMQSFLGDDTPLGELVDWINQDSNFPREVKSHSEILSYFRTNPCPESISVPVIKR
    N315            MSFYEFMQSFLGDDTPLGELVDWINQDSNFPREVKSHSEILSYFRTNPCPESISVPVIKR
    NCTC8325        MSFYEFMQSFLGDDTPLGELVDWINQDSNFPREVKSHSEILSYFRTNPCPESISVPVIKR
    Newman          MSFYEFMQSFLGDDTPLGELVDWINQDSNFPREVKSHSEILSYFRTNPCPESISVPVIKR
    USA300_FPR3757  MSFYEFMQSFLGDDTPLGELVDWINQDSNFPREVKSHSEILSYFRTNPCPESISVPVIKR
                    ************************************************************

    COL             ALSVFNQFTNVQ
    N315            ALSVFNQFTNVQ
    NCTC8325        ALSVFNQFTNVQ
    Newman          ALSVFNQFTNVQ
    USA300_FPR3757  ALSVFNQFTNVQ
                    ************