From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006202000
  • symbol?:
  • description?: CHAP domain-containing protein

      descriptions from strain specific annotations:

    • CHAP domain-containing protein
    • LysM domain-containing protein
    • secretory antigen SsaA-like protein
    • CHAP domain protein
    • CHAP protein
    • N-acetylmuramoyl-L-alanine amidase
    • SceB
    • secretory antigen precursor SsaA
    • Secretory antigen SsaA
    • secretory antigen ssaA2
  • strand?: +
  • coordinates?: 6263384..6263815
  • synteny block?: BlockID0049260
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2480
    08BA02176:
    C248_2601
    11819-97:
    MS7_2549
    71193:
    ST398NM01_2594
    ECT-R 2:
    ECTR2_2396
    ED133:
    SAOV_2588
    ED98:
    SAAV_2610
    HO 5096 0412:
    SAEMRSA15_24470
    JH1:
    SaurJH1_2620
    JH9:
    SaurJH9_2567
    JKD6008:
    SAA6008_02581
    JKD6159:
    SAA6159_02440
    LGA251:
    SARLGA251_23190
    M013:
    M013TW_2516
    MRSA252:
    SAR2624
    MSHR1132:
    SAMSHR1132_23640
    MSSA476:
    SAS2430
    Mu3:
    SAHV_2528
    Mu50:
    SAV2544
    MW2:
    MW2465
    RF122:
    SAB2418
    ST398:
    SAPIG2594
    T0131:
    SAT0131_02751
    TCH60:
    HMPREF0772_10647 (amiD2)
    TW20:
    SATW20_26650
    USA300_TCH1516:
    USA300HOU_2536
    VC40:
    SAVC_11595

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEYKKILIRLLIAFAVLFSADFTYQSVEQTHQSHAAVNYYSKNQCTWWAFKRRAQVGKPV
    N315            MEYKKILIRLLIAFAVLFSADFTYQSVEQTHQSHAAVNYYSKNQCTWWAFKRRAQVGKPV
    NCTC8325        MEYKKILIRLLIAFAVLFSADFTYQSVEQTHQSHAAVNYYSKNQCTWWAFKRRAQVGKPV
    Newman          MEYKKILIRLLIAFAVLFSADFTYQSVEQTHQSHAAVNYYSKNQCTWWAFKRRAQVGKPV
    USA300_FPR3757  MEYKKILIRLLIAFAVLFSADFTYQSVEQTHQSHAAVNYYSKNQCTWWAFKRRAQVGKPV
                    ************************************************************

    COL             SNRWGNAKNWYYNARKSKYATGRTPRKFAVMQSTAGYYGHVAVVEQVYKNGSIKVSEYNF
    N315            SNRWGNAKNWYYNARKSKYATGRTPRKFAVMQSTAGYYGHVAVVEQVYKNGSIKVSEYNF
    NCTC8325        SNRWGNAKNWYYNARKSKYATGRTPRKFAVMQSTAGYYGHVAVVEQVYKNGSIKVSEYNF
    Newman          SNRWGNAKNWYYNARKSKYATGRTPRKFAVMQSTAGYYGHVAVVEQVYKNGSIKVSEYNF
    USA300_FPR3757  SNRWGNAKNWYYNARKSKYATGRTPRKFAVMQSTAGYYGHVAVVEQVYKNGSIKVSEYNF
                    ************************************************************

    COL             YRPLKYNTRVLSKKAARNFNYIY
    N315            YRPLKYNTRVLSKKAARNFNYIY
    NCTC8325        YRPLKYNTRVLSKKAARNFNYIY
    Newman          YRPLKYNTRVLSKKAARNFNYIY
    USA300_FPR3757  YRPLKYNTRVLSKKAARNFNYIY
                    ***********************