From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006210000
  • symbol?: clpL
  • description?: ATP-dependent Clp proteinase subunit clpL

      descriptions from strain specific annotations:

    • ATP-dependent Clp proteinase subunit clpL
    • ATP-dependent Clp proteinase chain
    • ATPase
    • ATP-dependent Clp protease, putative
    • ATP-dependent protease ATP-binding subunit clpL
    • ATP-dependent Clp protease ATP-binding subunit clpL
    • AAA ATPase
    • ATP-dependent Clp protease, ATP-binding subunit ClpC
    • endopeptidase Clp
    • putative ATP-dependent protease ATP-bindingsubunit ClpL
    • chaperone ATPase
    • putative ATP-dependent Clp proteinase
    • ATP-dependent Clp proteinase chain clpL
    • ATP-dependent proteinase chain
  • strand?: +
  • coordinates?: 6270264..6272385
  • synteny block?: BlockID0049340
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2336 (clpL)
    NCTC8325:
    Newman:
    NWMN_2448 (clpC)
    USA300_FPR3757:
    04-02981:
    SA2981_2484 (clpL)
    08BA02176:
    C248_2605 (clpL)
    11819-97:
    MS7_2554
    71193:
    ST398NM01_2598
    ECT-R 2:
    ECTR2_2400
    ED133:
    SAOV_2592
    ED98:
    SAAV_2614
    HO 5096 0412:
    SAEMRSA15_24510 (clpL)
    JH1:
    SaurJH1_2624
    JH9:
    SaurJH9_2571
    JKD6008:
    SAA6008_02586
    JKD6159:
    SAA6159_02444
    LGA251:
    SARLGA251_23230 (clpL)
    M013:
    M013TW_2521
    MRSA252:
    SAR2628 (clpL)
    MSHR1132:
    SAMSHR1132_23680
    MSSA476:
    SAS2434
    Mu3:
    SAHV_2532 (clpL)
    Mu50:
    SAV2548 (clpL)
    MW2:
    MW2469 (clpL)
    RF122:
    SAB2423 (clpL)
    ST398:
    SAPIG2598
    T0131:
    SAT0131_02757
    TCH60:
    HMPREF0772_10643 (clpL)
    TW20:
    SATW20_26700 (clpL)
    USA300_TCH1516:
    USA300HOU_2542 (clp)
    VC40:
    SAVC_11620

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNNGFFNSDFDSIFRRMMKDMQGSNQVGNKKYYINGKEVSPEELAQLTQQGGNHSAEQSA
    N315            MNNGFFNSDFDSIFRRMMQDMQGSNQVGNKKYYINGKEVSPEELAQLTQQGSNQSAEQSA
    NCTC8325        MNNGFFNSDFDSIFRRMMKDMQGSNQVGNKKYYINGKEVSPEELAQLTQQGGNHSAEQSA
    Newman          MNNVFFNSDFDSIFRRMMKDMQGSNQVGNKKYYINGKEVSPEELAQLTQQGGNHSAEQSA
    USA300_FPR3757  MNNGFFNSDFDSIFRRMMKDMQGSNQVGNKKYYINGKEVSPEELAQLTQQGGNHSAEQSA
                    *** **************:********************************.*:******

    COL             QAFQQAAQRQQGQQGGNGNYLEQIGRNLTQEARDGLLDPVIGRDKEIQETAEVLSRRTKN
    N315            QAFQQAAQRQQGQQGGNGNYLEQIGRNLTQEARDGLLDPVIGRDKEIQETAEVLSRRTKN
    NCTC8325        QAFQQAAQRQQGQQGGNGNYLEQIGRNLTQEARDGLLDPVIGRDKEIQETAEVLSRRTKN
    Newman          QAFQQAAQRQQGQQGGNGNYLEQIGRNLTQEARDGLLDPVIGRDKEIQETAEVLSRRTKN
    USA300_FPR3757  QAFQQAAQRQQGQQGGNGNYLEQIGRNLTQEARDGLLDPVIGRDKEIQETAEVLSRRTKN
                    ************************************************************

    COL             NPILVGEAGVGKTAIVEGLAQAIVEGNVPAAIKDKEIISVDISSLEAGTQYRGAFEENIQ
    N315            NPILVGEAGVGKTAIVEGLAQAIVEGNVPAAIKDKEIISVDISSLEAGTQYRGAFEENIQ
    NCTC8325        NPILVGEAGVGKTAIVEGLAQAIVEGNVPAAIKDKEIISVDISSLEAGTQYRGAFEENIQ
    Newman          NPILVGEAGVGKTAIVEGLAQAIVEGNVPAAIKDKEIISVDISSLEAGTQYRGAFEENIQ
    USA300_FPR3757  NPILVGEAGVGKTAIVEGLAQAIVEGNVPAAIKDKEIISVDISSLEAGTQYRGAFEENIQ
                    ************************************************************

    COL             KLIEGVKSSQNAVLFFDEIHQIIGSGATGSDSGSKGLSDILKPALSRGEISIIGATTQDE
    N315            KLIEGVKSSQNAVLFFDEIHQIIGSGATGSDSGSKGLSDILKPALSRGEISIIGATTQDE
    NCTC8325        KLIEGVKSSQNAVLFFDEIHQIIGSGATGSDSGSKGLSDILKPALSRGEISIIGATTQDE
    Newman          KLIEGVKSSQNAVLFFDEIHQIIGSGATGSDSGSKGLSDILKPALSRGEISIIGATTQDE
    USA300_FPR3757  KLIEGVKSSQNAVLFFDEIHQIIGSGATGSDSGSKGLSDILKPALSRGEISIIGATTQDE
                    ************************************************************

    COL             YRNNILKDAALTRRFNEVLVNEPSAKDTVEILKGIREKFEEHHQVKLPDDVLKACVDLSI
    N315            YRNNILKDAALTRRFNEVLVNEPSAKDTVEILKGIREKFEEHHQVKLPDDVLKACVDLSI
    NCTC8325        YRNNILKDAALTRRFNEVLVNEPSAKDTVEILKGIREKFEEHHQVKLPDDVLKACVDLSI
    Newman          YRNNILKDAALTRRFNEVLVNEPSAKDTVEILKGIREKFEEHHQVKLPDDVLKACVDLSI
    USA300_FPR3757  YRNNILKDSALTRRFNEVLVNEPSAKDTVEILKGIREKFEEHHQVKLPDDVLKACVDLSI
                    ********:***************************************************

    COL             QYIPQRLLPDKAIDVLDITAAHLSAQSPAVDKVETEKRISELENDKRKAVSAEEYKKADD
    N315            QYIPQRLLPDKAIDVLDITAAHLSAQSPAVDKVETEKRISELENDKRKAVSAEEYKKADD
    NCTC8325        QYIPQRLLPDKAIDVLDITAAHLSAQSPAVDKVETEKRISELENDKRKAVSAEEYKKADD
    Newman          QYIPQRLLPDKAIDVLDITAAHLSAQSPAVDKVETEKRISELENDKRKAVSAEEYKKADD
    USA300_FPR3757  QYIPQRLLPDKAIDVLDITAAHLSAQSPAVDKVETEKRISELENDKRKAVSAEEYKKADD
                    ************************************************************

    COL             IQNEIKSLQDKLENSNGEHTAVATVHDISDTIQRLTGIPVSQMDDNDIERLKNISNRLRS
    N315            IQNEIKSLQDKLENSNGEHTAVATVHDISDTIQRLTGIPVSQMDDNDIERLKNISNRLRS
    NCTC8325        IQNEIKSLQDKLENSNGEHTAVATVHDISDTIQRLTGIPVSQMDDNDIERLKNISNRLRS
    Newman          IQNEIKSLQDKLENSNGEHTAVATVHDISDTIQRLTGIPVSQMDDNDIERLKNISNRLRS
    USA300_FPR3757  IQNEIKSLQDKLENSNGEHTAVATVHDISDTIQRLTGIPVSQMDDNDIERLKNISNRLRS
                    ************************************************************

    COL             KIIGQDQAVEMVSRAIRRNRAGFDDGNRPIGSFLFVGPTGVGKTELAKQLAIDLFGNKDA
    N315            KIIGQDQAVEMVSRAIRRNRAGFDDGNRPIGSFLFVGPTGVGKTELAKQLAIDLFGNKDA
    NCTC8325        KIIGQDQAVEMVSRAIRRNRAGFDDGNRPIGSFLFVGPTGVGKTELAKQLAIDLFGNKDA
    Newman          KIIGQDQAVEMVSRAIRRNRAGFDDGNRPIGSFLFVGPTGVGKTELAKQLAIDLFGNKDA
    USA300_FPR3757  KIIGQDQAVEMVSRAIRRNRAGFDDGNRPIGSFLFVGPTGVGKTELAKQLAIDLFGNKDA
                    ************************************************************

    COL             LIRLDMSEYSDTTAVSKMIGTTAGYVGYDDNSNTLTEKVRRNPYSVILFDEIEKANPQIL
    N315            LIRLDMSEYSDTTAVSKMIGTTAGYVGYDDNSNTLTEKVRRNPYSVILFDEIEKANPQIL
    NCTC8325        LIRLDMSEYSDTTAVSKMIGTTAGYVGYDDNSNTLTEKVRRNPYSVILFDEIEKANPQIL
    Newman          LIRLDMSEYSDTTAVSKMIGTTAGYVGYDDNSNTLTEKVRRNPYSVILFDEIEKANPQIL
    USA300_FPR3757  LIRLDMSEYSDTTAVSKMIGTTAGYVGYDDNSNTLTEKVRRNPYSVILFDEIEKANPQIL
                    ************************************************************

    COL             TLLLQVMDDGNLTDGQGNVINFKNTIIICTSNAGFGNGNDAEEKDIMHEMKKFFRPEFLN
    N315            TLLLQVMDDGNLTDGQGNVINFKNTIIICTSNAGFGNGNDAEEKDIMHEMKKFFRPEFLN
    NCTC8325        TLLLQVMDDGNLTDGQGNVINFKNTIIICTSNAGFGNGNDAEEKDIMHEMKKFFRPEFLN
    Newman          TLLLQVMDDGNLTDGQGNVINFKNTIIICTSNAGFGNGNDAEEKDIMHEMKKFFRPEFLN
    USA300_FPR3757  TLLLQVMDDGNLTDGQGNVINFKNTIIICTSNAGFGNGNDAEEKDIMHEMKKFFRPEFLN
                    ************************************************************

    COL             RFNGIVEFLHLDKDALQDIVNLLLDDVQVTLDKKGITMDVSQDAKDWLIEEGYDEELGAR
    N315            RFNGIVEFLHLDKDALQDIVNLLLDDVQVTLDKKGITMDVSQDAKDWLIEEGYDEELGAR
    NCTC8325        RFNGIVEFLHLDKDALQDIVNLLLDDVQVTLDKKGITMDVSQDAKDWLIEEGYDEELGAR
    Newman          RFNGIVEFLHLDKDALQDIVNLLLDDVQVTLDKKGITMDVSQDAKDWLIEEGYDEELGAR
    USA300_FPR3757  RFNGIVEFLHLDKDALQDIVNLLLDDVQVTLDKKGITMDVSQDAKDWLIEEGYDEELGAR
                    ************************************************************

    COL             PLRRIVEQQVRDKITDYYLDHTDVKHVDIDVEDNELVVKGK
    N315            PLRRIVEQQVRDKITDYYLDHTDVKHVDIDVEDNELVVKGK
    NCTC8325        PLRRIVEQQVRDKITDYYLDHTDVKHVDIDVEDNELVVKGK
    Newman          PLRRIVEQQVRDKITDYYLDHTDVKHVDIDVEDNELVVKGK
    USA300_FPR3757  PLRRIVEQQVRDKITDYYLDHTDVKHVDIDVEDNELVVKGK
                    *****************************************