From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006213000
  • symbol?: feoA
  • description?: ferrous iron transporter A

      descriptions from strain specific annotations:

    • ferrous iron transporter A
    • FeoA domain-containing protein
    • ferrous iron transport protein A
    • feoA domain protein
    • FeoA domain superfamily
    • FeoA family protein
  • strand?: -
  • coordinates?: 6274645..6274872
  • synteny block?: BlockID0049370
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2487
    08BA02176:
    C248_2608
    11819-97:
    MS7_2557
    71193:
    ST398NM01_2601
    ECT-R 2:
    ECTR2_2403
    ED133:
    SAOV_2595c
    ED98:
    SAAV_2617
    HO 5096 0412:
    SAEMRSA15_24540
    JH1:
    SaurJH1_2627
    JH9:
    SaurJH9_2573
    JKD6008:
    SAA6008_02589 (feoA)
    JKD6159:
    SAA6159_02447 (feoA)
    LGA251:
    SARLGA251_23260
    M013:
    M013TW_2524
    MRSA252:
    SAR2631
    MSHR1132:
    SAMSHR1132_23710
    MSSA476:
    SAS2437
    Mu3:
    SAHV_2535
    Mu50:
    SAV2551
    MW2:
    MW2472
    RF122:
    SAB2425c
    ST398:
    SAPIG2601
    T0131:
    SAT0131_02760
    TCH60:
    HMPREF0772_10640
    TW20:
    SATW20_26730
    USA300_TCH1516:
    USA300HOU_2545
    VC40:
    SAVC_11635

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLNIKNGEMNKAYKIKRMDIANENMLYRLSAFGLTDDAIITIKQKCLFKGPCIIEVNGQQ
    N315            MLNIKNGEMNKAYKIKRMDIANENMLYRLSAFGLTDDAIITIKQKCLFKGPCIIEVNGQQ
    NCTC8325        MLNIKNGEMNKAYKIKRMDIANENMLYRLSAFGLTDDAIITIKQKCLFKGPCIIEVNGQQ
    USA300_FPR3757  MLNIKNGEMNKAYKIKRMDIANENMLYRLSAFGLTDDAIITIKQKCLFKGPCIIEVNGQQ
                    ************************************************************

    COL             LSIRHCDACSIALEE
    N315            LSIRHCDACSIALEE
    NCTC8325        LSIRHCDACSIALEE
    USA300_FPR3757  LSIRHCDACSIALEE
                    ***************