From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006219000
  • symbol?: cwrA
  • description?: exported protein
  • strand?: +
  • coordinates?: 6281248..6281448
  • synteny block?: BlockID0049430
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2493
    08BA02176:
    C248_2614
    11819-97:
    MS7_2563
    71193:
    ST398NM01_2607
    ECT-R 2:
    ECTR2_2409
    ED133:
    SAOV_2601
    ED98:
    SAAV_2622
    HO 5096 0412:
    SAEMRSA15_24590
    JH1:
    SaurJH1_2632
    JH9:
    SaurJH9_2578
    JKD6008:
    SAA6008_02595
    JKD6159:
    SAA6159_02452
    LGA251:
    SARLGA251_23310
    M013:
    M013TW_2530
    MRSA252:
    SAR2636
    MSHR1132:
    SAMSHR1132_23770
    MSSA476:
    SAS2442
    Mu3:
    SAHV_2540
    Mu50:
    SAV2556
    MW2:
    MW2477
    RF122:
    SAB2430
    ST398:
    SAPIG2607
    T0131:
    SAT0131_02767 (cap1B)
    TCH60:
    HMPREF0772_10634
    TW20:
    SATW20_26780
    USA300_TCH1516:
    USA300HOU_2551
    VC40:
    SAVC_11660

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRILITGTVAILIILGLVKTIQDYEMTNDTSRQLSDNKDDDKVIHLNNFKNLHAKEFNPS
    N315            MRILITGTVAILIILGLVKTIQDYEMTNDTSRQLSDNKDDDKVIHLNNFKNLHAKEFNPS
    NCTC8325        MRILITGTVAILIILGLVKTIQDYEMTNDTSRQLSDNKDDDKVIHLNNFKNLHAKEFNPS
    Newman          MRILITGTVAILIILGLVKTIQDYEMTNDTSRQLSDNKDDDKVIHLNNFKNLHAKEFNPS
    USA300_FPR3757  MRILITGTVAILIILGLVKTIQDYEMTNDTSRQLSDNKDDDKVIHLNNFKNLHAKEFNPS
                    ************************************************************

    COL             DFF
    N315            DFF
    NCTC8325        DFF
    Newman          DFF
    USA300_FPR3757  DFF
                    ***