From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006222000
  • symbol?: copZ
  • description?: mercuric ion-binding protein

      descriptions from strain specific annotations:

    • mercuric ion-binding protein
    • copper ion binding protein
    • heavy-metal-associated protein
    • copper chaperone copZ
    • cation transporter E1-E2 family ATPase
    • heavy metal-binding protein
    • MerTP family mercury (Hg2+) permease, binding protein MerP
    • copper chaperone copZ (Copper-ion-binding protein)
    • putative heavy-metal-associated protein
    • MerTP family copper permease, binding protein CopZ
  • strand?: +
  • coordinates?: 6285504..6285719
  • synteny block?: BlockID0049460
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2495
    08BA02176:
    C248_2616
    11819-97:
    MS7_2565 (copZ)
    71193:
    ST398NM01_2609
    ECT-R 2:
    ECTR2_2411
    ED133:
    SAOV_2603
    ED98:
    SAAV_2624
    HO 5096 0412:
    SAEMRSA15_24610
    JH1:
    SaurJH1_2634
    JH9:
    SaurJH9_2580
    JKD6008:
    SAA6008_02597 (merP)
    JKD6159:
    SAA6159_02454 (merP)
    LGA251:
    SARLGA251_23330
    M013:
    M013TW_2532
    MRSA252:
    SAR2639
    MSHR1132:
    SAMSHR1132_23790
    MSSA476:
    SAS2444
    Mu3:
    SAHV_2542
    Mu50:
    SAV2558
    MW2:
    MW2479
    RF122:
    ST398:
    SAPIG2609
    T0131:
    SAT0131_02769 (icaR)
    TCH60:
    HMPREF0772_10631 (copZ)
    TW20:
    SATW20_26800
    USA300_TCH1516:
    USA300HOU_2553 (merP)
    VC40:
    SAVC_11670

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSQEILNVEGMSCGHCKSAVESALNNIDGVTSADVNLENGQVSVQYDDSKVAVSQMKDAI
    N315            MSQEILNVEGMSCGHCKSAVESALNNIDGVTSADVNLENGQVSVQYDDSKVAVSQMKDAI
    NCTC8325        MSQEILNVEGMSCGHCKSAVESALNNIDGVTSADVNLENGQVSVQYDDSKVAVSQMKDAI
    Newman          MSQEILNVEGMSCGHCKSAVESALNNIDGVTSADVNLENGQVSVQYDDSKVAVSQMKDAI
    USA300_FPR3757  MSQEILNVEGMSCGHCKSAVESALNNIDGVTSADVNLENGQVSVQYDDSKVAVSQMKDAI
                    ************************************************************

    COL             EDQGYDVV
    N315            EDQGYDVV
    NCTC8325        EDQGYDVV
    Newman          EDQGYDVV
    USA300_FPR3757  EDQGYDVV
                    ********