From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006223000
  • symbol?:
  • description?: D-lactate dehydrogenase

      descriptions from strain specific annotations:

    • D-lactate dehydrogenase
    • lactate dehydrogenase
    • D-isomer specific 2-hydroxyacid dehydrogenase
    • D-isomer specific 2-hydroxyacid dehydrogenase family protein
    • D-lactate dehydrogenase (D-LDH) (D-specific D-2-hydroxyacid dehydrogenase)
    • D-specific D-2-hydroxyacid dehydrogenase ddh
    • D-specific D-2-hydroxyacid dehydrogenase ddh-like protein
  • strand?: -
  • coordinates?: 6285810..6286808
  • synteny block?: BlockID0049470
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2496 (ddh)
    08BA02176:
    C248_2617
    11819-97:
    MS7_2566
    71193:
    ST398NM01_2610
    ECT-R 2:
    ECTR2_2412
    ED133:
    SAOV_2604c
    ED98:
    SAAV_2625
    HO 5096 0412:
    SAEMRSA15_24620
    JH1:
    SaurJH1_2635
    JH9:
    SaurJH9_2581
    JKD6008:
    SAA6008_02598
    JKD6159:
    SAA6159_02455
    LGA251:
    SARLGA251_23340
    M013:
    M013TW_2533
    MRSA252:
    SAR2640
    MSHR1132:
    SAMSHR1132_23800
    MSSA476:
    SAS2445
    Mu3:
    SAHV_2543
    Mu50:
    SAV2559
    MW2:
    MW2480
    RF122:
    SAB2432c
    ST398:
    SAPIG2610
    T0131:
    SAT0131_02770
    TCH60:
    HMPREF0772_10630 (ldhD)
    TW20:
    SATW20_26810
    USA300_TCH1516:
    USA300HOU_2554
    VC40:
    SAVC_11675

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKIKIMSVRDEDMPYIKAWAEKHHVEVDITKEALTDDNVEGVAGYDGLSLSQQIPLSEH
    N315            MTKIKIMSVRDEDMPYIKAWAEKHHVEVDITKEALTDDNVEGVAGYDGLSLSQQIPLSEH
    NCTC8325        MTKIKIMSVRDEDMPYIKAWAEKHHVEVDITKEALTDDNVEGVAGYDGLSLSQQIPLSEH
    Newman          MTKIKIMSVRDEDMPYIKAWAEKHHVEVDITKEALTDDNVEGVAGYDGLSLSQQIPLSEH
    USA300_FPR3757  MTKIKIMSVRDEDMPYIKAWAEKHHVEVDITKEALTDDNVEGVAGYDGLSLSQQIPLSEH
                    ************************************************************

    COL             VYKRLNELGIKQIAQRSAGFDTYDLELANKYNFIVSNVPSYSPNSIAEFAVNQAINVVRH
    N315            VYKRLNELGIKQIAQRSAGFDTYDLELANKYNLIVSNVPSYSPNSIAEFAVNQAINVVRH
    NCTC8325        VYKRLNELGIKQIAQRSAGFDTYDLELANKYNFIVSNVPSYSPNSIAEFAVNQAINVVRH
    Newman          VYKRLNELGIKQIAQRSAGFDTYDLELANKYNFIVSNVPSYSPNSIAEFAVNQAINVVRH
    USA300_FPR3757  VYKRLNELGIKQIAQRSAGFDTYDLELANKYNFIVSNVPSYSPNSIAEFAVNQAINVVRH
                    ********************************:***************************

    COL             FNQIQTKVREHDFRWEPTILSKSIKDLKVAVIGTGRIGRVVADIFANGYQSDVVAYDPFP
    N315            FNQIQTKVREHDFRWEPTILSKSIKDLKVAVIGTGRIGRVVADIFANGYQSDVVAYDPFP
    NCTC8325        FNQIQTKVREHDFRWEPTILSKSIKDLKVAVIGTGRIGRVVADIFANGYQSDVVAYDPFP
    Newman          FNQIQTKVREHDFRWEPTILSKSIKDLKVAVIGTGRIGRVVADIFANGYQSDVVAYDPFP
    USA300_FPR3757  FNQIQTKVREHDFRWEPTILSKSIKDLKVAVIGTGRIGRVVADIFANGYQSDVVAYDPFP
                    ************************************************************

    COL             NAKIATYVDYKDTIEEAVEGADIVTLHVPATKYNHYLFNAELFKHFKKGAVFVNCARGSL
    N315            NAKIATYVDYKDTIEEAVEGADIVTLHVPATKYNHYLFNAELFKHFKKGAVFVNCARGSL
    NCTC8325        NAKIATYVDYKDTIEEAVEGADIVTLHVPATKYNHYLFNAELFKHFKKGAVFVNCARGSL
    Newman          NAKIATYVDYKDTIEEAVEGADIVTLHVPATKYNHYLFNAELFKHFKKGAVFVNCARGSL
    USA300_FPR3757  NAKIATYVDYKDTIEEAVEGADIVTLHVPATKYNHYLFNAELFKHFKKGAVFVNCARGSL
                    ************************************************************

    COL             VDTKALLDALDNGVIKGAALDTYEFERKLFPSDQRGKTLNDPLLESLIDREDVILTPHIA
    N315            VDTKALLDALDNGVIKGAALDTYEFERKLFPSDQRGKTPNDPLLESLIDREDVILTPHIA
    NCTC8325        VDTKALLDALDNGVIKGAALDTYEFERKLFPSDQRGKTLNDPLLESLIDREDVILTPHIA
    Newman          VDTKALLDALDNGVIKGAALDTYEFERKLFPSDQRGKTLNDPLLESLIDREDVILTPHIA
    USA300_FPR3757  VDTKALLDALDNGVIKGAALDTYEFERKLFPSDQRGKTLNDPLLESLIDREDVILTPHIA
                    ************************************** *********************

    COL             FYTEAAVKNLIVDALDATLDVLQTGDTRLRVN
    N315            FYTEAAVKNLIVDALDATLDVLQTGDTRLRVN
    NCTC8325        FYTEAAVKNLIVDALDATLDVLQTGDTRLRVN
    Newman          FYTEAAVKNLIVDALDATLDVLQTGDTRLRVN
    USA300_FPR3757  FYTEAAVKNLIVDALDATLDVLQTGDTRLRVN
                    ********************************