From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006230000
  • symbol?:
  • description?: secretory antigen precursor SsaA

      descriptions from strain specific annotations:

    • secretory antigen precursor SsaA
    • CHAP domain-containing protein
    • staphylococcal secretory antigen ssaA
    • staphyloxanthin biosynthesis protein
    • LysM domain-containing protein
    • secretory antigen precursor SsaA-like protein
    • secretory antigen ssaA2
    • Staphylococcal secretory antigen ssaA1
  • strand?: -
  • coordinates?: 6294429..6295223
  • synteny block?: BlockID0049540
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_2466 (oatA)
    USA300_FPR3757:
    04-02981:
    SA2981_2503 (ssaA)
    08BA02176:
    C248_2624 (ssaA)
    11819-97:
    MS7_2573
    71193:
    ST398NM01_2617
    ECT-R 2:
    ECTR2_2419
    ED133:
    SAOV_2611c
    ED98:
    SAAV_2632
    HO 5096 0412:
    SAEMRSA15_24690 (ssaA)
    JH1:
    SaurJH1_2642
    JH9:
    SaurJH9_2588
    JKD6008:
    SAA6008_02605
    JKD6159:
    SAA6159_02462
    LGA251:
    SARLGA251_23410 (ssaA)
    M013:
    M013TW_2540
    MRSA252:
    SAR2648 (ssaA)
    MSHR1132:
    SAMSHR1132_23820
    MSSA476:
    SAS2452
    Mu3:
    SAHV_2550
    Mu50:
    SAV2566
    MW2:
    MW2487
    RF122:
    SAB2439c (ssaA)
    ST398:
    SAPIG2617
    T0131:
    SAT0131_02777
    TCH60:
    HMPREF0772_10623 (ssaA)
    TW20:
    SATW20_26880 (ssaA)
    USA300_TCH1516:
    USA300HOU_2561
    VC40:
    SAVC_11710

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKIVTATIATAGLATIAFAGHDAQAAEQNNNGYNSNDAQSYSYTYTIDAQGNYHYTWTG
    N315            MKKIVTATIATAGLATIAFAGHDAQAAEQNNNGYNSNDAQSYSYTYTIDAQGNYHYTWTG
    NCTC8325        MKKIVTATIATAGLATIAFAGHDAQAAEQNNNGYNSNDAQSYSYTYTIDAQGNYHYTWTG
    Newman          MKKIVTATIATAGLATIAFAGHDAQAAEQNNNGYNSNDAQSYSYTYTIDAQGNYHYTWTG
    USA300_FPR3757  MKKIVTATIATAGLATIAFAGHDAQAAEQNNNGYNSNDAQSYSYTYTIDAQGNYHYTWTG
                    ************************************************************

    COL             NWNPSQLTQNNTYYYNNYNTYSYNNASYNNYYNHSYQYNNYTNNSQTATNNYYTGGSGAS
    N315            NWNPSQLTQNNTYYYNNYNTYSYNNASYNNYYNHSYQYNNYTNNSQTATNNYYTGGSGAS
    NCTC8325        NWNPSQLTQNNTYYYNNYNTYSYNNASYNNYYNHSYQYNNYTNNSQTATNNYYTGGSGAS
    Newman          NWNPSQLTQNNTYYYNNYNTYSYNNASYNNYYNHSYQYNNYTNNSQTATNNYYTGGSGAS
    USA300_FPR3757  NWNPSQLTQNNTYYYNNYNTYSYNNASYNNYYNHSYQYNNYTNNSQTATNNYYTGGSGAS
                    ************************************************************

    COL             YSTTSNNVHVTTTAAPSSNGRSISNGYASGSNLYTSGQCTYYVFDRVGGKIGSTWGNASN
    N315            YSTTSNNVHVTTTAAPSSNGRSISNGYASGSNLYTSGQCTYYVFDRVGGKIGSTWGNASN
    NCTC8325        YSTTSNNVHVTTTAAPSSNGRSISNGYASGSNLYTSGQCTYYVFDRVGGKIGSTWGNASN
    Newman          YSTTSNNVHVTTTAAPSSNGRSISNGYASGSNLYTSGQCTYYVFDRVGGKIGSTWGNASN
    USA300_FPR3757  YSTTSNNVHVTTTAAPSSNGRSISNGYASGSNLYTSGQCTYYVFDRVGGKIGSTWGNASN
                    ************************************************************

    COL             WANAAASSGYTVNNTPKVGAIMQTTQGYYGHVAYVEGVNSNGSVRVSEMNYGHGAGVVTS
    N315            WANAAASSGYTVNNTPKVGAIMQTTQGYYGHVAYVEGVNSNGSVRVSEMNYGHGAGVVTS
    NCTC8325        WANAAASSGYTVNNTPKVGAIMQTTQGYYGHVAYVEGVNSNGSVRVSEMNYGHGAGVVTS
    Newman          WANAAASSGYTVNNTPKVGAIMQTTQGYYGHVAYVEGVNSNGSVRVSEMNYGHGAGVVTS
    USA300_FPR3757  WANAAASSGYTVNNTPKVGAIMQTTQGYYGHVAYVEGVNSNGSVRVSEMNYGHGAGVVTS
                    ************************************************************

    COL             RTISANQAGSYNFIH
    N315            RTISANQAGSYNFIH
    NCTC8325        RTISANQAGSYNFIH
    Newman          RTISANQAGSYNFIH
    USA300_FPR3757  RTISANQAGSYNFIH
                    ***************